DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RAB21 and rhb1

DIOPT Version :9

Sequence 1:NP_055814.1 Gene:RAB21 / 23011 HGNCID:18263 Length:225 Species:Homo sapiens
Sequence 2:NP_595194.1 Gene:rhb1 / 2540853 PomBaseID:SPBC428.16c Length:185 Species:Schizosaccharomyces pombe


Alignment Length:185 Identity:55/185 - (29%)
Similarity:92/185 - (49%) Gaps:11/185 - (5%)


- Green bases have known domain annotations that are detailed below.


Human    19 SFKVVLLGEGCVGKTSLVLRYCENKFNDKHITTLQASFLTKKLNIGGKRVNLAIWDTAGQERFHA 83
            |.::.:||...|||:||.::|.||.|.:.:..|::.:| :|.:...|:.....|.|||||:.:..
pombe     6 SRRIAVLGSRSVGKSSLTVQYVENHFVESYYPTIENTF-SKNIKYKGQEFATEIIDTAGQDEYSI 69

Human    84 LGPIYYRDSNGAILVYDITDEDSFQKVKNWVKELRKMLGNE-ICLCIVGNKIDLEKERHVSIQEA 147
            |...:....:|.:|||.||.:.||:.||....::....|.| :.:.:||||.||..:|.|:.:|.
pombe    70 LNSKHSIGIHGYVLVYSITSKSSFEMVKIVRDKILNHTGTEWVPIVVVGNKSDLHMQRAVTAEEG 134

Human   148 ESYAESVGAKHYHTSAKQNKGIEELFLDLCKRMIETAQVDERAKGNGSSQPGTAR 202
            ::.|..........||:.|:.:...|     .:|    :.|..|....|.||..:
pombe   135 KALANEWKCAWTEASARHNENVARAF-----ELI----ISEIEKQANPSPPGDGK 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RAB21NP_055814.1 Rab21 20..181 CDD:133323 48/161 (30%)
Ras 21..182 CDD:278499 48/161 (30%)
rhb1NP_595194.1 small_GTPase 5..170 CDD:197466 51/173 (29%)
RheB 6..184 CDD:206709 55/185 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.