DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RAB21 and ypt1

DIOPT Version :9

Sequence 1:NP_055814.1 Gene:RAB21 / 23011 HGNCID:18263 Length:225 Species:Homo sapiens
Sequence 2:NP_596205.1 Gene:ypt1 / 2539784 PomBaseID:SPBC1703.10 Length:203 Species:Schizosaccharomyces pombe


Alignment Length:205 Identity:72/205 - (35%)
Similarity:119/205 - (58%) Gaps:8/205 - (3%)


- Green bases have known domain annotations that are detailed below.


Human    18 YSFKVVLLGEGCVGKTSLVLRYCENKFNDKHITTLQASFLTKKLNIGGKRVNLAIWDTAGQERFH 82
            |.||::|:|:..|||:.|:||:.::.:.:.:|:|:...|..:...:.||.|.|.||||||||||.
pombe     7 YLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTFELEGKTVKLQIWDTAGQERFR 71

Human    83 ALGPIYYRDSNGAILVYDITDEDSFQKVKNWVKELRKMLGNEICLCIVGNKIDLEKERHVSIQEA 147
            .:...|||.::|.|:|||:||:|||..||.|::|:.:.....:...:||||.|:..::.|....|
pombe    72 TITSSYYRGAHGIIIVYDVTDQDSFNNVKQWLQEIDRYAVEGVNRLLVGNKSDMVDKKVVEYSVA 136

Human   148 ESYAESVGAKHYHTSAKQNKGIEELFLDLCKRMIETAQVDERAKGNGSSQPGTARRGVQIIDDEP 212
            :.:|:|:......||||.:..:|:.||.:.:      |:.|| .||.:.....|:..|::.....
pombe   137 KEFADSLNIPFLETSAKDSTNVEQAFLTMSR------QIKER-MGNNTFASSNAKSSVKVGQGTN 194

Human   213 QAQTSGGGCC 222
            .:|:| ..||
pombe   195 VSQSS-SNCC 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RAB21NP_055814.1 Rab21 20..181 CDD:133323 60/160 (38%)
Ras 21..182 CDD:278499 59/160 (37%)
ypt1NP_596205.1 Rab1_Ypt1 7..172 CDD:206661 62/170 (36%)
RAB 9..172 CDD:197555 61/168 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.