DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RAB21 and rab-21

DIOPT Version :9

Sequence 1:NP_055814.1 Gene:RAB21 / 23011 HGNCID:18263 Length:225 Species:Homo sapiens
Sequence 2:NP_495854.1 Gene:rab-21 / 187932 WormBaseID:WBGene00004279 Length:207 Species:Caenorhabditis elegans


Alignment Length:207 Identity:110/207 - (53%)
Similarity:152/207 - (73%) Gaps:9/207 - (4%)


- Green bases have known domain annotations that are detailed below.


Human    16 RAYSFKVVLLGEGCVGKTSLVLRYCENKFNDKHITTLQASFLTKKLNIGGKRVNLAIWDTAGQER 80
            :::.||:||||||||||:|||||:.||||:.||::|:||||..|.:|:...:.:|.||||||||:
 Worm     9 KSFKFKIVLLGEGCVGKSSLVLRFVENKFSCKHLSTIQASFQNKTVNVEDCQADLHIWDTAGQEK 73

Human    81 FHALGPIYYRDSNGAILVYDITDEDSFQKVKNWVKELRKMLGNEICLCIVGNKIDLEKERHVSIQ 145
            :|||||||||.|||.:||:||||..||:||||||.|::..|||...:.|||||||||:||.|:.|
 Worm    74 YHALGPIYYRGSNGVLLVFDITDRKSFEKVKNWVLEIKTCLGNTAEILIVGNKIDLEEERQVTRQ 138

Human   146 EAESYAESVGAKHYHTSAKQNKGIEELFLDLCKRMIETAQVDERAKGNGSSQPGTARRGVQIIDD 210
            :||:||||.||.:..|||:.|.||.:.|..|..:|||.::       ..|::|.:..|.:::||:
 Worm   139 DAEAYAESEGALYMETSAQDNVGISDAFESLTAKMIEHSR-------TRSTEPPSTNRSIRLIDN 196

Human   211 EPQAQTSGGGCC 222
            : :|:.| ..||
 Worm   197 D-EAERS-KKCC 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RAB21NP_055814.1 Rab21 20..181 CDD:133323 98/160 (61%)
Ras 21..182 CDD:278499 98/160 (61%)
rab-21NP_495854.1 Rab21 13..174 CDD:133323 98/160 (61%)
Ras 14..175 CDD:278499 98/160 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C161472020
Domainoid 1 1.000 202 1.000 Domainoid score I1923
eggNOG 1 0.900 - - E1_KOG0088
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H8991
Inparanoid 1 1.050 218 1.000 Inparanoid score I2634
Isobase 1 0.950 - 0 Normalized mean entropy S698
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1226895at2759
OrthoFinder 1 1.000 - - FOG0006095
OrthoInspector 1 1.000 - - oto23197
orthoMCL 1 0.900 - - OOG6_103363
Panther 1 1.100 - - LDO PTHR24073
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3888
SonicParanoid 1 1.000 - - X4390
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1615.780

Return to query results.
Submit another query.