DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAPRE3 and CG2955

DIOPT Version :10

Sequence 1:NP_036458.2 Gene:MAPRE3 / 22924 HGNCID:6892 Length:281 Species:Homo sapiens
Sequence 2:NP_608817.1 Gene:CG2955 / 33622 FlyBaseID:FBgn0031585 Length:565 Species:Drosophila melanogaster


Alignment Length:167 Identity:54/167 - (32%)
Similarity:83/167 - (49%) Gaps:17/167 - (10%)


- Green bases have known domain annotations that are detailed below.


Human    16 SRHDMLAWVNDSLHLNYTKIEQLCSGAAYCQFMDMLFPGCVHLRKVKFQAKLEHEYIHNFKVLQA 80
            ||..:|.|:|::|...|.::|:|.:||.||:.:..|.|..:.|::|..:.|..:|.:.|.|:||.
  Fly    14 SRRRILGWINNNLGTTYVRLEELRTGAEYCRMLHKLQPSAIRLKRVFKEPKSHYECVQNMKLLQK 78

Human    81 AFKKMGVDKIIPVEKLVKGKFQDNFEFIQWFKKFFDANYDGKDYNPLLARQGQDVAPPP-----N 140
            :..|.||:|.||:::||.....::.||.||||.|:|.|:.      ||..:..:.||.|     .
  Fly    79 SLLKQGVEKQIPIQRLVSRGNSESLEFAQWFKAFYDHNHQ------LLWPEKTEDAPKPLEKFDE 137

Human   141 PGDQIFNKSKKLIGTAVPQRTSPTGPKNMQTSGRLSN 177
            ..|...:..|...|.....|...|      .|.|.||
  Fly   138 KPDSFVDTGKCRYGARCSHRLDST------VSSRHSN 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAPRE3NP_036458.2 BIM1 16..279 CDD:227542 54/167 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 157..181 6/21 (29%)
DCTN1-binding 217..281
APC-binding 217..260
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 261..281
CG2955NP_608817.1 BIM1 10..>116 CDD:227542 39/101 (39%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.