DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAPRE3 and CG15306

DIOPT Version :9

Sequence 1:NP_001289979.1 Gene:MAPRE3 / 22924 HGNCID:6892 Length:281 Species:Homo sapiens
Sequence 2:NP_001259403.1 Gene:CG15306 / 31961 FlyBaseID:FBgn0030191 Length:357 Species:Drosophila melanogaster


Alignment Length:301 Identity:85/301 - (28%)
Similarity:140/301 - (46%) Gaps:66/301 - (21%)


- Green bases have known domain annotations that are detailed below.


Human     6 YSTSVTSENL---SRHDMLAWVNDSLHLNYTKIEQLCSGAAYCQFMDMLFPGCVHLRKVKFQAKL 67
            ::.:||..:|   ||.|:|.|.|::|..|...|||||:|||||..|.||:|..::|::|||.:..
  Fly     7 HNVTVTHNSLVQWSRGDILDWFNETLQCNLINIEQLCTGAAYCNLMHMLYPKLINLKRVKFFSNQ 71

Human    68 EHEYIHNFKVLQAAFKKMGVDKIIPVEKLVKGKFQDNFEFIQWFKKFFDANYDGKD----YNPLL 128
            |:||::|||.||.||.|:.|.....|..|:||...:||:|..||:.||:.|:. ||    |:.|:
  Fly    72 EYEYVNNFKELQKAFNKVNVSLPAEVNDLIKGHRVENFKFAVWFRHFFNVNHT-KDKCAGYDALV 135

Human   129 ARQGQDVAPPPNPGDQIFNKSK----KLIGTAVPQRTSP----------TGPKNMQTSGRLSNVA 179
            ||..|::.   ....::..|.:    |:..||:..:.:.          ||..|.....:.::  
  Fly   136 ARDHQNIG---IGSSKLTTKDRFRLVKVKTTAIRGKVATCQATINSSLCTGKANQDEDSQHTD-- 195

Human   180 PPCILRKNPPSARNGGHETDAQILELNQQLVDLKLTVDGLEKERDFYF-------SKLRDIELIC 237
                 :|:..|...|....|:.  .::.|..|.        :::|..:       |:.:|    |
  Fly   196 -----KKDEDSRDQGSQYEDSP--GMDSQYKDC--------RDQDSQYEDSHGKDSQYKD----C 241

Human   238 QEHESENSPVISGIIGILYATEEGF-APPEDDEIEEHQQED 277
            ::..|:            |....|. :..||...::.|.||
  Fly   242 RDQGSQ------------YEDSHGMDSQYEDSRDQDSQYED 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAPRE3NP_001289979.1 BIM1 16..279 CDD:227542 82/288 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 157..181 3/33 (9%)
DCTN1-binding 217..281 12/69 (17%)
APC-binding 217..260 6/49 (12%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 261..281 6/18 (33%)
CG15306NP_001259403.1 CH 20..103 CDD:278723 40/82 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158826
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5217
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1237523at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10623
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
65.810

Return to query results.
Submit another query.