DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAPRE3 and CG32371

DIOPT Version :10

Sequence 1:NP_036458.2 Gene:MAPRE3 / 22924 HGNCID:6892 Length:281 Species:Homo sapiens
Sequence 2:NP_729295.1 Gene:CG32371 / 317999 FlyBaseID:FBgn0052371 Length:294 Species:Drosophila melanogaster


Alignment Length:291 Identity:112/291 - (38%)
Similarity:164/291 - (56%) Gaps:43/291 - (14%)


- Green bases have known domain annotations that are detailed below.


Human     3 VNVYSTSVTSENLSRHDMLAWVNDSLHLNYTKIEQLCSGAAYCQFMDMLFPGCVHLRKVKFQAKL 67
            |||..|:..|.|.||.:||:|||::|...:.|:|:||:||||||.||:||...:.:::|||:..:
  Fly    10 VNVRYTNKLSSNSSRAEMLSWVNNTLKSQFFKVEELCTGAAYCQLMDILFARSIPMQRVKFRTNV 74

Human    68 EHEYIHNFKVLQAAFKKMGVDKIIPVEKLVKGKFQDNFEFIQWFKKFFDANYDGKDYNPLLARQG 132
            |:|||.|||:||..|.|..||||||:::||||::||||||:|||:|||||||:.::|:|::||.|
  Fly    75 EYEYIQNFKLLQGCFNKFVVDKIIPIDRLVKGRYQDNFEFLQWFRKFFDANYESREYDPVIARNG 139

Human   133 Q--DVAPPPNPGDQIFNKSKKLIGTAVPQRTSPTGPKNMQTSGRLSNVAPPCILRKNP--PSARN 193
            .  .:..||...     |.:|.:..:.|| |.||...:.||. |.:......:.:.|.  .:...
  Fly   140 AMLGLGSPPMEA-----KLRKSVNKSNPQ-TKPTEESSAQTD-RATTEPKNQVYKSNSENKTIEE 197

Human   194 GGHETDAQILELNQQLVD--LKLT-----------------------------VDGLEKERDFYF 227
            ...:||..|.|...|:.:  .|.|                             |..:::||:||.
  Fly   198 ASAQTDLAITEPENQVHESQTKTTEKASAQTEKATTEPDSEGSIEELRNYCKYVSRMKQERNFYL 262

Human   228 SKLRDIELICQEHESENSPVI-SGIIGILYA 257
            ||||.|:.|||::.|....|| ..|..|:|:
  Fly   263 SKLRAIDHICQKYNSGRDRVILEKITKIIYS 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAPRE3NP_036458.2 BIM1 16..279 CDD:227542 106/278 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 157..181 8/23 (35%)
DCTN1-binding 217..281 18/42 (43%)
APC-binding 217..260 18/42 (43%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 261..281
CG32371NP_729295.1 BIM1 23..>269 CDD:227542 96/252 (38%)
EB1 254..293 CDD:460870 17/38 (45%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.