DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NCBP2 and Cbp20

DIOPT Version :9

Sequence 1:NP_031388.2 Gene:NCBP2 / 22916 HGNCID:7659 Length:156 Species:Homo sapiens
Sequence 2:NP_524396.1 Gene:Cbp20 / 42166 FlyBaseID:FBgn0022943 Length:154 Species:Drosophila melanogaster


Alignment Length:138 Identity:108/138 - (78%)
Similarity:123/138 - (89%) Gaps:0/138 - (0%)


- Green bases have known domain annotations that are detailed below.


Human    15 VELSQYRDQHFRGDNEEQEKLLKKSCTLYVGNLSFYTTEEQIYELFSKSGDIKKIIMGLDKMKKT 79
            ||||.||||||:|...|||:.|:.||||||||||||||||||:||||:.||::.|:|||||.|||
  Fly     5 VELSSYRDQHFKGSRSEQERSLRDSCTLYVGNLSFYTTEEQIHELFSRCGDVRVIVMGLDKYKKT 69

Human    80 ACGFCFVEYYSRADAENAMRYINGTRLDDRIIRTDWDAGFKEGRQYGRGRSGGQVRDEYRQDYDA 144
            .|||||||||.|::||.|||::||||||||:||.||||||.||||||||::|||||||||.||||
  Fly    70 PCGFCFVEYYVRSEAEAAMRFVNGTRLDDRLIRVDWDAGFVEGRQYGRGKTGGQVRDEYRTDYDA 134

Human   145 GRGGYGKL 152
            ||||||||
  Fly   135 GRGGYGKL 142

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
NCBP2NP_031388.2 RRM_NCBP2 42..119 CDD:409686 59/76 (78%)
mRNA cap-binding 112..116 2/3 (67%)
mRNA cap-binding 123..127 3/3 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 124..156 26/29 (90%)