DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment RALY and Neos

DIOPT Version :9

Sequence 1:	NP_057951.1	Gene:	RALY / 22913	HGNCID:	15921	Length:	306	Species:	Homo sapiens
Sequence 2:	NP_001261502.1	Gene:	Neos / 38795	FlyBaseID:	FBgn0024542	Length:	371	Species:	Drosophila melanogaster

Alignment Length:	101	Identity:	34/101 - (33%)
Similarity:	47/101 - (46%)	Gaps:	14/101 - (13%)

- Green bases have known domain annotations that are detailed below.

Human     9 NVTNKNDPKSINSRVFIGNLNTALVKKSDVETIFSKYGRVAGCSVHKGYAFVQYSNERHARAAVL 73
            |:|  .||....||:|:|||  .:..:.::.:|...||:|.|..|.|.|.|||:..|..|..|
  Fly    10 NIT--KDPALAKSRIFLGNL--PVCTREELVSICQPYGKVLGSMVQKNYGFVQFETEELANKA-- 68

Human    74 GENGRVLAGQTLDINMAGEPKPDRPKGLK-RAASAI 108
               ...|...|...||.    ..|...:| :||:||
  Fly    69 ---ASALHKSTFKQNML----TVRNASIKSKAANAI 97

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
RALY	NP_057951.1	RRM_RALY	20..95	CDD:241048	24/74 (32%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	215..306
		Epitope (recognized by BKRF1 antibodies)	227..253
Neos	NP_001261502.1	U2AF_lg	<19..149	CDD:273727	30/90 (33%)
Neos	NP_001261502.1	RRM_SF	20..78	CDD:388407	22/64 (34%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.910