DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CARD8 and atln-1

DIOPT Version :9

Sequence 1:NP_001171829.1 Gene:CARD8 / 22900 HGNCID:17057 Length:537 Species:Homo sapiens
Sequence 2:NP_001023492.1 Gene:atln-1 / 177059 WormBaseID:WBGene00021868 Length:573 Species:Caenorhabditis elegans


Alignment Length:286 Identity:53/286 - (18%)
Similarity:89/286 - (31%) Gaps:116/286 - (40%)


- Green bases have known domain annotations that are detailed below.


Human   326 HPEDIKFHLYLVPSDALLTKAIDDEEDRFHGVRLQT--------SPPMEP--------------- 367
            |.||:     |:|.:....:.::..||..|...|.|        .|.:..               
 Worm    20 HVEDV-----LLPKEPQAVRVVEVVEDTDHSFELNTELLEKILLDPKVADKKVAVIGVAGAYRKG 79

Human   368 ----LNFGSSYIVSNSANLKVMPKELKL---SYRSPGE-IQHFSKFYAGQMKEPIQLEITEKRHG 424
                |||...|:...|...||| .|::|   .:.||.. :..|| :..|..::         .:|
 Worm    80 KSFLLNFFLRYLTWRSKADKVM-GEVELDNSQWMSPNSPLSGFS-WRGGSERD---------TNG 133

Human   425 TLVWDTEVKPVDLQLVAASAPPPFSGAAFVKE-NHRQLQARMGDLKGVL---------------- 472
            .|:|.                .||    .:|: |..::...:.|.:|..                
 Worm   134 ILIWS----------------EPF----IMKDKNGEEIAVLLMDTQGAFDSQSTVKDCATIFALS 178

Human   473 -----------------DDLQDNEVLTENEKELVEQEKTRQSKNEALLSMVE------------K 508
                             ||||..::.||..:..:|...::..  ::||.:|.            :
 Worm   179 TMISSVQIYNLSQNIQEDDLQHLQLFTEYGRLALEDSASKPF--QSLLFLVRDWSFPYEAEFGFQ 241

Human   509 KGDLALDVLFRSISERDPYLVSYLRQ 534
            .|...||... .:||:....:..|||
 Worm   242 GGQRVLDRRL-EVSEKQHAELQQLRQ 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CARD8NP_001171829.1 ZU5. /evidence=ECO:0000303|PubMed:22087307 161..296
FIIND 182..436 CDD:316110 29/140 (21%)
UPA. /evidence=ECO:0000303|PubMed:22087307 297..446 29/150 (19%)
CARD 453..535 CDD:306972 22/128 (17%)
atln-1NP_001023492.1 P-loop_NTPase 43..325 CDD:393306 46/258 (18%)
GBP_C 351..>447 CDD:308475
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.