DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Npepl1 and S-Lap4

DIOPT Version :9

Sequence 1:NP_001365722.1 Gene:Npepl1 / 228961 MGIID:2448523 Length:529 Species:Mus musculus
Sequence 2:NP_729613.1 Gene:S-Lap4 / 326188 FlyBaseID:FBgn0052064 Length:524 Species:Drosophila melanogaster


Alignment Length:405 Identity:91/405 - (22%)
Similarity:147/405 - (36%) Gaps:92/405 - (22%)


- Green bases have known domain annotations that are detailed below.


Mouse   143 SGASRRAEKRTVMVEFFLVGQD------NGPVEVSTLQCLTNA---------------------T 180
            :|...|:.:...:.|.|:.|.|      .|.|......|..|:                     |
  Fly   126 AGIGARSLQEIGVSEVFVDGMDYAEQAAEGAVLAVWRYCDMNSKRKPPHIPKLELYESPDYEGWT 190

Mouse   181 EGV------RLAARIVDTPCNEMNTDIFLEEIIQVGKELGITPTIIRDEQLKTKGFGGIYGVGKA 239
            .||      .||.|:.|||...|...:|.:..:......|||..|...|.::.:.......:.|.
  Fly   191 RGVFKAEAQNLARRMCDTPACCMTPTLFAQATVDALCPCGITVEIRTMEWIEQQRLHSFLMIAKG 255

Mouse   240 ALHPPALAILSH---TPDGATQTIAWVGKGIVYDTGGLSIKGKTTMPGMKRDCGGAAAVLGAFRA 301
            :..||.|..:::   .|:  .:.|.::||||.:::|.::::....|...:....|||:.:...|.
  Fly   256 SCEPPVLMEITYCGTNPE--DKPILFLGKGITFNSGAMNLRKCRGMEEYRACMSGAASCVAMMRC 318

Mouse   302 AIKQGFKDNLHAVFCLAENAVGPNATRPDDIHLLYSGKTVEINNTDAEGRLVLADGVSYACKDLG 366
            ........|:..:..|.||.....|.:|.|:..|.:.|::.:.|.|..|.:|:||.:.|......
  Fly   319 VAALALPINVCCIIPLCENMPSGMACKPGDVVTLMNHKSMAVRNLDKAGVVVMADPLLYGQSTYK 383

Mouse   367 ADIIVDMATL---------TGAQGIATGKYH-------AAVLTNSAEWEAACVKAGRKCGDLVHP 415
            ..::||:|||         .||.||.:..::       |..||....|........||       
  Fly   384 PRLVVDVATLGSGVKKAFGGGATGIFSNSHYIWKQFQSAGALTGDRVWRLPLWNYYRK------- 441

Mouse   416 LVYCPELHFSEFTSAVA-DMKNSVADRDNSPSSCAGLFIASHIGFDWPGV-WVHLDIAAPVHAGE 478
                      :.|..:. |:.|   |.....:||....:...:   .|.| |.|||        .
  Fly   442 ----------QITDEMGYDLSN---DGRGLANSCLAAAVLHEL---VPCVDWAHLD--------T 482

Mouse   479 RATGFGVALLLALFG 493
            |.||     ||..:|
  Fly   483 RGTG-----LLTKYG 492

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Npepl1NP_001365722.1 Peptidase_M17 35..492 CDD:238247 90/402 (22%)
S-Lap4NP_729613.1 PRK00913 31..514 CDD:234863 91/405 (22%)
Peptidase_M17 35..514 CDD:238247 91/405 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0260
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.