DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZBTB1 and CG10321

DIOPT Version :9

Sequence 1:NP_001116801.1 Gene:ZBTB1 / 22890 HGNCID:20259 Length:713 Species:Homo sapiens
Sequence 2:NP_001261124.1 Gene:CG10321 / 37464 FlyBaseID:FBgn0034643 Length:855 Species:Drosophila melanogaster


Alignment Length:468 Identity:87/468 - (18%)
Similarity:159/468 - (33%) Gaps:157/468 - (33%)


- Green bases have known domain annotations that are detailed below.


Human   333 DIPTDELKDFNIIKVTDKDCNESTDNDELEDEPEEPF-------YRYYVEEDVSIKKSGRKTL-- 388
            ::..:||:|  :.:..|...:.|.:...|:|:.::.|       ::..:.||::..:|.....  
  Fly   340 EVEDEELED--VYEQLDSKADHSFETIVLDDDQQQDFLKDHHEHHQVMINEDLTQSESQDHEYFD 402

Human   389 ----KPRMSVSADERGGLENMRPPNNSSPVQEDAENASCELCGLTITEEDLSSHYLAKHIENICA 449
                :..|....||.   |.|:|       :||.:....|...|   |:|               
  Fly   403 DLDQQQAMDEIEDEE---EQMKP-------EEDQDTFIIEEIQL---EDD--------------- 439

Human   450 CGKCGQIL--VKGRQLQEHAQRCGEPQDLTMNGLGNTEEKMDLEENPDEQSEIRDMFVEMLDDFR 512
                 ::|  ..|.::.:..:..||.||..::|..:.:.:..:.|.||.::.: |:....:|..:
  Fly   440 -----EMLDDPDGEEIDQDCEYIGEEQDPHLSGDVDDDLEYSIMEPPDGETSV-DIDQAFMDSEQ 498

Human   513 DNHYQ----INSI---------------------------------QKKQLFKH--------SAC 532
            .:|.|    :.||                                 ::.:...|        ..|
  Fly   499 SHHQQHQEEMQSISLENAVVEFSQATTTTEALVGPTMTVSSASPTPKRAKRSNHQIPAGVTLEPC 563

Human   533 PFRCPNCG-------------QRFETENLVVEHMSSCLDQDMFKSAIMEENERDHRR-----KHF 579
            ..:.|..|             |..:|.:::.  .:...|.....:.::.|..|.|..     ::.
  Fly   564 DHQPPAAGSTTSSKLAAANSRQLVQTASVIA--AAGADDNYEIDANLVTEFIRQHTSPLGSGRYI 626

Human   580 CNLCGKGFYQRCHLREHYTVHTK------EKQFVCQTCGKQFLRERQLRLHNDMHKGMARYVCSI 638
            |:||...|.|...|:.|...||.      :||..||.|.|.|.....||:|              
  Fly   627 CHLCSTEFRQFKGLQNHMHSHTNWIRANCKKQPQCQICLKSFKGPGMLRMH-------------- 677

Human   639 CDQGNFRKHDHVRHMISHLSAGETICQVCFQIFPNNEQLEQHMDVH---LYTCGICGAKFNLRKD 700
                 .:.||        ..:...:|.:|.:.|.:...|.:|...|   .|.||:.    |.||:
  Fly   678 -----MKTHD--------AESSTPMCTICNRTFKSKAILYRHRQTHQQRAYCCGVA----NCRKN 725

Human   701 MRSHYNAK-HLKR 712
            ..|..|.| |::|
  Fly   726 FSSAVNLKWHVER 738

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZBTB1NP_001116801.1 BTB_POZ_ZBTB1 3..116 CDD:349501
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 160..179
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 270..320
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 384..416 6/37 (16%)
C2H2 Zn finger 536..574 CDD:275368 7/50 (14%)
C2H2 Zn finger 580..600 CDD:275368 7/19 (37%)
C2H2 Zn finger 608..628 CDD:275368 8/19 (42%)
C2H2 Zn finger 636..656 CDD:275368 2/19 (11%)
C2H2 Zn finger 664..684 CDD:275368 5/19 (26%)
C2H2 Zn finger 688..709 CDD:275371 8/21 (38%)
CG10321NP_001261124.1 zf-AD 12..80 CDD:214871
ASF1_hist_chap <405..516 CDD:304562 28/144 (19%)
C2H2 Zn finger 627..647 CDD:275368 7/19 (37%)
C2H2 Zn finger 661..681 CDD:275368 8/38 (21%)
C2H2 Zn finger 690..710 CDD:275368 5/19 (26%)
C2H2 Zn finger 717..740 CDD:275368 10/26 (38%)
C2H2 Zn finger 750..767 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24399
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.