Sequence 1: | NP_002005.1 | Gene: | FKBP4 / 2288 | HGNCID: | 3720 | Length: | 459 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001246448.1 | Gene: | Fkbp14 / 37449 | FlyBaseID: | FBgn0010470 | Length: | 220 | Species: | Drosophila melanogaster |
Alignment Length: | 200 | Identity: | 65/200 - (32%) |
---|---|---|---|
Similarity: | 92/200 - (46%) | Gaps: | 29/200 - (14%) |
- Green bases have known domain annotations that are detailed below.
Human 50 GDRVFVHYTGWL-LDGTKFDSSLDRKDKFSFDLGKGEVIKAWDIAIATMKVGEVCHITCKPEYAY 113
Human 114 GSAGSPPKIPPNATLVFEVELFEFKGEDLTEEEDGGIIRRIQTRGEGYAKPNEGAIVEVALEGYY 178
Human 179 KDKLF-----DQRELRFEIGEGENLDLPYGLERAIQRMEKGEHSIVYLKPSYAFGSVGKEKFQIP 238
Human 239 PNAEL 243 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
FKBP4 | NP_002005.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..24 | ||
FKBP_C | 43..134 | CDD:306713 | 43/84 (51%) | ||
FKBP_N | <155..254 | CDD:332399 | 17/93 (18%) | ||
TPR_11 | <250..>395 | CDD:330823 | |||
Interaction with tubulin. /evidence=ECO:0000250 | 267..400 | ||||
TPR repeat | 274..301 | CDD:276809 | |||
TPR repeat | 306..348 | CDD:276809 | |||
TPR repeat | 353..381 | CDD:276809 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 421..459 | ||||
Fkbp14 | NP_001246448.1 | FKBP_C | 37..130 | CDD:278674 | 44/85 (52%) |
EF-hand_7 | 140..212 | CDD:290234 | 15/90 (17%) | ||
EFh | 141..212 | CDD:298682 | 15/89 (17%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0545 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |