DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FKBP4 and CG1847

DIOPT Version :9

Sequence 1:NP_002005.1 Gene:FKBP4 / 2288 HGNCID:3720 Length:459 Species:Homo sapiens
Sequence 2:NP_001368980.1 Gene:CG1847 / 32144 FlyBaseID:FBgn0030345 Length:390 Species:Drosophila melanogaster


Alignment Length:391 Identity:98/391 - (25%)
Similarity:138/391 - (35%) Gaps:122/391 - (31%)


- Green bases have known domain annotations that are detailed below.


Human    50 GDRVFVHY-TGWLLDGTKFDSSLDRKDKFSFDLGKGEVIKAWDIAIATMKVGEVCHIT-----CK 108
            |.||..|: |....|....|.|...:......|||...::.|::.:..|.:.||...|     | 
  Fly    29 GTRVKFHFQTRRAGDSRIIDDSRKMEKPMELVLGKKFKLEVWELIVQQMSLNEVAKFTVHKSLC- 92

Human   109 PEYAYGS-----AGSPPKIPPNATLVFEVELFEFKGEDLTEEEDGGIIRRIQTRGEGYAKPNEGA 168
            .:|.:.|     .|..|                       ||........:|..|.||.      
  Fly    93 AQYPFISKTLRDIGKKP-----------------------EERRHCCGMTLQNEGIGYT------ 128

Human   169 IVEVALEGYYKDKLFDQRELRFEIGEGENLDLPYGLERAIQRMEKGEHSIVYLKPSYAFGSVGKE 233
                           |..||         |..|..||..|                        |
  Fly   129 ---------------DLDEL---------LQNPSDLEFII------------------------E 145

Human   234 KFQIPPNAEL--KYELHLKSFEKAKESWEMNSEEKLEQSTIVKERGTVYFKEGKYKQALLQYKK- 295
            .|.|    ||  :||         ||.|:|:.:||:..::.::|||..::|..::.:|...|:: 
  Fly   146 LFSI----ELPEQYE---------KERWQMSDDEKMLATSTLRERGNNFYKASRFTEAETCYREA 197

Human   296 --IVSWLEYESSFSNEEAQKAQALRLASHLNLAMCHLKLQAFSAAIESCNKALELDSNNEKGLFR 358
              ||..|..:....:||.|:..|::....||.|.|.|....|.|.||.||:.|.||..|.|.|||
  Fly   198 VGIVEQLMLKEKPHDEEWQELAAIKTPLLLNYAQCRLIAGDFYAVIEHCNEVLTLDPRNVKALFR 262

Human   359 RGEAHLAVNDFELARADFQKVLQLYPNNKAA----------KTQLAVCQQRIRRQLAREKKLYAN 413
            |.:||....:...||.||...|.|..:.|:.          :.|....|.||..|     ||: |
  Fly   263 RAKAHAGAWNPAQARRDFLDALALDASLKSTVSKELKSIEDQQQARNVQDRIHMQ-----KLFXN 322

Human   414 M 414
            :
  Fly   323 I 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FKBP4NP_002005.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24
FKBP_C 43..134 CDD:306713 21/94 (22%)
FKBP_N <155..254 CDD:332399 19/100 (19%)
TPR_11 <250..>395 CDD:330823 49/157 (31%)
Interaction with tubulin. /evidence=ECO:0000250 267..400 44/145 (30%)
TPR repeat 274..301 CDD:276809 8/29 (28%)
TPR repeat 306..348 CDD:276809 16/41 (39%)
TPR repeat 353..381 CDD:276809 11/27 (41%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 421..459
CG1847NP_001368980.1 FKBP_C 23..>92 CDD:395196 16/62 (26%)
3a0801s09 150..>308 CDD:273380 53/166 (32%)
TPR repeat 173..217 CDD:276809 11/43 (26%)
TPR repeat 222..252 CDD:276809 12/29 (41%)
TPR repeat 257..285 CDD:276809 11/27 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.