DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NLGN1 and alpha-Est2

DIOPT Version :9

Sequence 1:NP_001352852.1 Gene:NLGN1 / 22871 HGNCID:14291 Length:843 Species:Homo sapiens
Sequence 2:NP_001262345.1 Gene:alpha-Est2 / 40908 FlyBaseID:FBgn0015570 Length:566 Species:Drosophila melanogaster


Alignment Length:642 Identity:169/642 - (26%)
Similarity:268/642 - (41%) Gaps:176/642 - (27%)


- Green bases have known domain annotations that are detailed below.


Human    38 LQAGHVLSQKLDDVDPLVATNFGKIRGIKKE--LNNEILGPVIQFLGVPYAAPPTGERRFQPPEP 100
            |..||.:         ::.|.:|::||::::  .:.|   |...|.|:|||.||.|:.||:.|:|
  Fly    27 LSTGHTV---------ILDTKYGQVRGLQRKTVYDKE---PYFAFEGIPYAKPPVGDLRFRAPQP 79

Human   101 PSPWSDIRNAT--QFAPVCPQNIIDGRLPEVMLPVWFTNNLDVVSSYVQDQSEDCLYLNIYVPTE 163
            |.||..:.|.|  :..|: .:|::.|                     :.:.|||||:||:||.. 
  Fly    80 PEPWQGVLNCTTNRSKPM-QRNMLLG---------------------IVEGSEDCLHLNVYVKA- 121

Human   164 DGPLTKKQTDDLGDNDGAEDEDIRDSGGPKPVMVYIHGGSYMEG--TGNLYDGSVLASYGNVIVI 226
                                   ..|..|.||:|:|:||.:.:|  :.::|....... ..|:.:
  Fly   122 -----------------------LKSEKPLPVIVWIYGGGFQKGEASRDIYSPDYFMK-KPVVFV 162

Human   227 TVNYRLGVLGFLSTGDQA--AKGNYGLLDLIQALRWTSENIGFFGGDPLRITVFGSGAGGSCVNL 289
            .:||||..|||||..|..  ..||.||.|.:.||||.|:||..|.|||..||:.|..||.:.|::
  Fly   163 AINYRLAALGFLSLKDPKLDVPGNAGLKDQVMALRWISQNIAHFNGDPNNITLMGESAGSASVHV 227

Human   290 LTLSHYSEGNRWSNSTKGLFQRAIAQSGTALSSWAVSFQPAKYARMLATKVGCNVSD-TVELVEC 353
            :..         :..|:|||.:||.|||.|||.| |......:|..||..:|....: ..:::..
  Fly   228 MMT---------TEQTRGLFHKAIMQSGCALSEW-VESPDNNWAFRLAQNLGYKGDEKDADVLSF 282

Human   354 LQKKPYKEL--VDQDI---QPARYHI--AFGPVI-----DGDVIPDDPQILMEQGEFLNYDIMLG 406
            |.|...:::  :|||:   ...|..:  ||||||     |..|:|...:.|:.:....:..:::|
  Fly   283 LSKVCARQIAAIDQDVINLDEVRSFLLFAFGPVIEPYETDHCVVPKRHKDLLSEAWGNDIPVIVG 347

Human   407 VNQGEGLKFVENIVDSDDGISASDFDFAVSNFVDNLYGYP---------EGKDVLRETIKFMYTD 462
            .|..||| |...:|..|        .:|:.||.:.|   |         ||:|:|...:|.:|.:
  Fly   348 GNSFEGL-FSYQLVRKD--------PWALKNFHNIL---PREVRETSSLEGQDLLVRRLKQLYFN 400

Human   463 ---------------------WADRHNPETRRKTLLALFTDHQWVAPAVATADLHSNFGSPTYFY 506
                                 |.|.|      :.:||    .|..||...|.....:|.|| :|.
  Fly   401 NEMQESMEMFEALNIFSHRQIWHDTH------RFILA----RQSYAPKTPTYLYRFDFDSP-HFN 454

Human   507 AFYHHCQTDQVPAWADAAHGDEVPYVLGIPMIGPTELFPCNFSKNDVMLSAV--VMTYWTNFAKT 569
            .|......|::   ...||.||:.|:.       ..:......|:.:....:  ::..||:||.:
  Fly   455 QFRRLVCGDRI---RGVAHADELSYLF-------YNIIASKLDKSSMEYKTIERMVGMWTSFASS 509

Human   570 GDPNQPVPQDTKF--IHTKPNRFEE-------------------VAWTRYSQKDQLY 605
            |:||.|.....|:  :..|.|..|:                   ..|..:..::.|:
  Fly   510 GNPNCPELGSAKWEAVQLKENAVEKCFNISHDLEMRDLPESDCLAVWDTFYPRESLF 566

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NLGN1NP_001352852.1 COesterase 53..626 CDD:365897 166/627 (26%)
alpha-Est2NP_001262345.1 COesterase 32..523 CDD:278561 161/592 (27%)
Aes <117..>221 CDD:223730 42/128 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165142644
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1516
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.