DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CPEB3 and HRP1

DIOPT Version :9

Sequence 1:XP_006717777.1 Gene:CPEB3 / 22849 HGNCID:21746 Length:715 Species:Homo sapiens
Sequence 2:NP_014518.1 Gene:HRP1 / 853997 SGDID:S000005483 Length:534 Species:Saccharomyces cerevisiae


Alignment Length:267 Identity:54/267 - (20%)
Similarity:101/267 - (37%) Gaps:71/267 - (26%)


- Green bases have known domain annotations that are detailed below.


Human   401 DNIMALNTRSYGRRRGRSSLFPFEDAFLDDSHGDQALSSGLSSPTRCQNGERVERYSR------- 458
            ::..:.|..:.....|.|.| |:|......|...|..|   .||.:.|..:..|..|:       
Yeast    98 ESATSANANANASSAGPSGL-PWEQLQQTMSQFQQPSS---QSPPQQQVTQTKEERSKADLSKES 158

Human   459 -KVFVGGLPPDIDEDEITASFRRFGPL----VVDWPHKAESKSYFPPKGYAFLLFQEESSVQALI 518
             |:|:|||..|..||.:...|.::|.:    ::..|....|      :|:.||.|::.|||..::
Yeast   159 CKMFIGGLNWDTTEDNLREYFGKYGTVTDLKIMKDPATGRS------RGFGFLSFEKPSSVDEVV 217

Human   519 DACLEEDGKLYLCVSSPTIKDKPVQIRPWNLSDSDFVMDGSQPLDPRKT-----------IFVGG 572
                                            .:..::|| :.:||::.           |||||
Yeast   218 --------------------------------KTQHILDG-KVIDPKRAIPRDEQDKTGKIFVGG 249

Human   573 VPRPLRAVELAMIMDRLYGGVCYAGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHNDI 637
            :...:|..|......: :|.:..|.:..|.:....:|.|.|.:.:..:.......:|:..:    
Yeast   250 IGPDVRPKEFEEFFSQ-WGTIIDAQLMLDKDTGQSRGFGFVTYDSADAVDRVCQNKFIDFK---- 309

Human   638 DKRVEVK 644
            |:::|:|
Yeast   310 DRKIEIK 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CPEB3XP_006717777.1 RRM1_CPEB2_like 458..549 CDD:241168 19/102 (19%)
RRM2_CPEB2_like 566..646 CDD:241170 17/90 (19%)
CEBP_ZZ 641..702 CDD:318563 2/4 (50%)
HRP1NP_014518.1 PABP-1234 <144..463 CDD:130689 42/217 (19%)
RRM1_Hrp1p 161..236 CDD:409991 22/113 (19%)
RRM2_Hrp1p 244..321 CDD:409767 17/78 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.