DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HSPA4L and Hsp70Bc

DIOPT Version :10

Sequence 1:NP_001304310.1 Gene:HSPA4L / 22824 HGNCID:17041 Length:870 Species:Homo sapiens
Sequence 2:NP_650209.1 Gene:Hsp70Bc / 48583 FlyBaseID:FBgn0013279 Length:641 Species:Drosophila melanogaster


Alignment Length:33 Identity:7/33 - (21%)
Similarity:16/33 - (48%) Gaps:0/33 - (0%)


- Green bases have known domain annotations that are detailed below.


Human   133 NPEMQFKPNTPETVEASAVSGKPPNGFSAIYKT 165
            :|::..||.|...::...|:.:..:....|:.|
  Fly   120 SPDLSLKPTTMVLLDGVYVASRKGHDIKYIFST 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HSPA4LNP_001304310.1 ASKHA_NBD_HSP70_HSPA4L 33..415 CDD:466844 7/33 (21%)
Hsp70BcNP_650209.1 PTZ00009 2..641 CDD:240227 7/33 (21%)

Return to query results.
Submit another query.