DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MTF2 and IntS12

DIOPT Version :10

Sequence 1:NP_031384.1 Gene:MTF2 / 22823 HGNCID:29535 Length:593 Species:Homo sapiens
Sequence 2:NP_651507.1 Gene:IntS12 / 43227 FlyBaseID:FBgn0039459 Length:328 Species:Drosophila melanogaster


Alignment Length:118 Identity:33/118 - (27%)
Similarity:48/118 - (40%) Gaps:34/118 - (28%)


- Green bases have known domain annotations that are detailed below.


Human    40 KKPACKFEEGQDVLARWSDGLFYLGTIKKINILKQSCFIIFEDSSKSWVLWKDIQTGATGS-GEM 103
            |:|:    :..|.:|...|||..:|.                           :.||.||. |::
  Fly    96 KEPS----DSVDTIADSDDGLSAVGI---------------------------VNTGDTGDFGDL 129

Human   104 VCTICQEEYSEAPNEMVICDKCGQGYHQLCHTPHI--DSSVIDSDEKWLCRQC 154
            .|.:|.|....|.|.::.|.|||..|||.||.|.|  :.:..|.::.|.|..|
  Fly   130 NCCVCGEMVFTATNRLIECSKCGAMYHQECHKPPITKEEAADDQEQNWQCDTC 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MTF2NP_031384.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..35
Tudor_MTF2 45..98 CDD:410521 8/52 (15%)
PHD1_MTF2 104..156 CDD:277053 20/53 (38%)
PHD2_MTF2 203..254 CDD:277055
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 360..411
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 424..486
Mtf2_C 544..591 CDD:464077
IntS12NP_651507.1 PHD_Int12 130..182 CDD:276976 19/51 (37%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.