DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment COPG1 and gammaCOP

DIOPT Version :10

Sequence 1:NP_057212.1 Gene:COPG1 / 22820 HGNCID:2236 Length:874 Species:Homo sapiens
Sequence 2:NP_001263145.1 Gene:gammaCOP / 43717 FlyBaseID:FBgn0028968 Length:897 Species:Drosophila melanogaster


Alignment Length:81 Identity:23/81 - (28%)
Similarity:35/81 - (43%) Gaps:15/81 - (18%)


- Green bases have known domain annotations that are detailed below.


Human    19 KYRCPACRVPYC-SVACFQKHKEQCNSEARPVEKSPTVVPVRTEENKGDDSSIADFLNSDEEDDR 82
            :|.| .|.|..| .|.|:..::.:|...|.|:.        ||..|:...|.: |.|  :|.|.|
  Fly    75 RYSC-VCAVRKCVYVCCYHINRTECEQSALPLN--------RTSLNRASWSDM-DLL--EEVDLR 127

Human    83 VSVQSLKNLVFTANPA 98
            .|.:..  |::...||
  Fly   128 ESSEYW--LIYATPPA 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
COPG1NP_057212.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21 0/1 (0%)
SEC21 7..869 CDD:227565 23/81 (28%)
HEAT 1 64..101 10/35 (29%)
HEAT 2 283..320
HEAT repeat 288..313 CDD:293787
HEAT 3 322..355
HEAT repeat 323..354 CDD:293787
HEAT 4 356..392
HEAT repeat 363..397 CDD:293787
HEAT repeat 398..423 CDD:293787
HEAT repeat 435..461 CDD:293787
HEAT repeat 471..501 CDD:293787
Interaction with ZNF289/ARFGAP2. /evidence=ECO:0000269|PubMed:14690497 609..874
gammaCOPNP_001263145.1 SEC21 11..877 CDD:227565 23/81 (28%)
HEAT repeat 402..427 CDD:293787
HEAT repeat 439..465 CDD:293787
HEAT repeat 475..505 CDD:293787
HEAT repeat 512..538 CDD:293787
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.