DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MRAS and RAS1

DIOPT Version :9

Sequence 1:NP_001078518.1 Gene:MRAS / 22808 HGNCID:7227 Length:208 Species:Homo sapiens
Sequence 2:NP_014744.1 Gene:RAS1 / 854268 SGDID:S000005627 Length:309 Species:Saccharomyces cerevisiae


Alignment Length:163 Identity:96/163 - (58%)
Similarity:129/163 - (79%) Gaps:1/163 - (0%)


- Green bases have known domain annotations that are detailed below.


Human    14 YKLVVVGDGGVGKSALTIQFFQKIFVPDYDPTIEDSYLKHTEIDNQWAILDVLDTAGQEEFSAMR 78
            ||:||||.||||||||||||.|..||.:|||||||||.|...||::.:|||:||||||||:||||
Yeast    11 YKIVVVGGGGVGKSALTIQFIQSYFVDEYDPTIEDSYRKQVVIDDKVSILDILDTAGQEEYSAMR 75

Human    79 EQYMRTGDGFLIVYSVTDKASFEHVDRFHQLILRVKDRESFPMILVANKVDLMHLRKITREQGKE 143
            |||||||:|||:|||||.:.||:.:..::|.|.||||.:..|:::|.||:||.:.|:::.|.|..
Yeast    76 EQYMRTGEGFLLVYSVTSRNSFDELLSYYQQIQRVKDSDYIPVVVVGNKLDLENERQVSYEDGLR 140

Human   144 MATKHNIPYIETSAKDPPLNVDKAFHDLVRVIR 176
            :|.:.|.|::|||||. .:|||:||:.|:|::|
Yeast   141 LAKQLNAPFLETSAKQ-AINVDEAFYSLIRLVR 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MRASNP_001078518.1 M_R_Ras_like 12..176 CDD:133345 95/161 (59%)
Effector region 42..50 7/7 (100%)
RAS1NP_014744.1 small_GTPase 9..172 CDD:197466 95/161 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24070
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.