DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RRAS2 and rras

DIOPT Version :9

Sequence 1:NP_036382.2 Gene:RRAS2 / 22800 HGNCID:17271 Length:204 Species:Homo sapiens
Sequence 2:NP_001107720.1 Gene:rras / 100135709 XenbaseID:XB-GENE-493188 Length:203 Species:Xenopus tropicalis


Alignment Length:191 Identity:147/191 - (76%)
Similarity:164/191 - (85%) Gaps:0/191 - (0%)


- Green bases have known domain annotations that are detailed below.


Human    13 EKYRLVVVGGGGVGKSALTIQFIQSYFVTDYDPTIEDSYTKQCVIDDRAARLDILDTAGQEEFGA 77
            |||:||||||||||||||||||||||||:||||||||||||.|.||.:..|||||||||||||||
 Frog    12 EKYKLVVVGGGGVGKSALTIQFIQSYFVSDYDPTIEDSYTKICSIDGKQTRLDILDTAGQEEFGA 76

Human    78 MREQYMRTGEGFLLVFSVTDRGSFEEIYKFQRQILRVKDRDEFPMILIGNKADLDHQRQVTQEEG 142
            ||||||||||||||:|::.|||||.|:.||..|||||||||||||||:|||||||.|||||:||.
 Frog    77 MREQYMRTGEGFLLIFAINDRGSFNEMSKFHTQILRVKDRDEFPMILVGNKADLDLQRQVTKEEA 141

Human   143 QQLARQLKVTYMEASAKIRMNVDQAFHELVRVIRKFQEQECPPSPEPTRKEKDKKGCHCVI 203
            ...||:..:.|||||||||:|||::||||||.||||||.||||:|....|:|:.|.|.|||
 Frog   142 LSFARENHIPYMEASAKIRLNVDESFHELVRAIRKFQELECPPTPAVNPKKKESKSCPCVI 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RRAS2NP_036382.2 M_R_Ras_like 13..176 CDD:133345 129/162 (80%)
Effector region 43..51 7/7 (100%)
rrasNP_001107720.1 M_R_Ras_like 12..175 CDD:133345 129/162 (80%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
NCBI 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1259506at2759
OrthoFinder 1 1.000 - - FOG0000092
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1068
SonicParanoid 1 1.000 - - X1567
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.950

Return to query results.
Submit another query.