DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FKBP1A and Fkbp39

DIOPT Version :9

Sequence 1:NP_000792.1 Gene:FKBP1A / 2280 HGNCID:3711 Length:108 Species:Homo sapiens
Sequence 2:NP_524364.2 Gene:Fkbp39 / 41860 FlyBaseID:FBgn0013269 Length:357 Species:Drosophila melanogaster


Alignment Length:103 Identity:47/103 - (45%)
Similarity:61/103 - (59%) Gaps:1/103 - (0%)


- Green bases have known domain annotations that are detailed below.


Human     2 GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQ 66
            ||::.....|.|.. .|:|:...|:|.|.|:...|...|..:.|||||.||..|||:||:.|||.
  Fly   252 GVKIVDQVVGKGEE-AKQGKRVSVYYIGRLQSNNKTFDSLLKGKPFKFALGGGEVIKGWDVGVAG 315

Human    67 MSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVEL 104
            |.||.:..:|..|..||||.|.|..|.|::||||:|||
  Fly   316 MKVGGKRVITCPPHMAYGARGAPPKIGPNSTLVFEVEL 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FKBP1ANP_000792.1 FkpA <2..106 CDD:223619 47/103 (46%)
Fkbp39NP_524364.2 FKBP_C 262..354 CDD:278674 44/93 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0545
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.