DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FKBP1A and Fkbp14

DIOPT Version :9

Sequence 1:NP_000792.1 Gene:FKBP1A / 2280 HGNCID:3711 Length:108 Species:Homo sapiens
Sequence 2:NP_001246448.1 Gene:Fkbp14 / 37449 FlyBaseID:FBgn0010470 Length:220 Species:Drosophila melanogaster


Alignment Length:107 Identity:54/107 - (50%)
Similarity:72/107 - (67%) Gaps:2/107 - (1%)


- Green bases have known domain annotations that are detailed below.


Human     3 VQVETIS-PGDGRTFPKRGQTCVVHYTGMLE-DGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVA 65
            ::||.|| |.......|.|.:..:||||.|: ||||||||.||::||.|.||..:||:||::|:.
  Fly    26 LKVEVISTPEVCEQKSKNGDSLTMHYTGTLQADGKKFDSSFDRDQPFTFQLGAGQVIKGWDQGLL 90

Human    66 QMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKL 107
            .|.||::.||||.|...||..|...:|||.|||:|||||:.:
  Fly    91 NMCVGEKRKLTIPPQLGYGDQGAGNVIPPKATLLFDVELINI 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FKBP1ANP_000792.1 FkpA <2..106 CDD:223619 54/104 (52%)
Fkbp14NP_001246448.1 FKBP_C 37..130 CDD:278674 48/92 (52%)
EF-hand_7 140..212 CDD:290234
EFh 141..212 CDD:298682
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0545
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.