DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FKBP1A and zda

DIOPT Version :10

Sequence 1:NP_000792.1 Gene:FKBP1A / 2280 HGNCID:3711 Length:108 Species:Homo sapiens
Sequence 2:NP_611353.1 Gene:zda / 37144 FlyBaseID:FBgn0034368 Length:397 Species:Drosophila melanogaster


Alignment Length:106 Identity:28/106 - (26%)
Similarity:58/106 - (54%) Gaps:10/106 - (9%)


- Green bases have known domain annotations that are detailed below.


Human     9 SPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRA 73
            :|.|....|.||:...|::||.|::|...::..:    |:..:|..|||:|.:..:..:.||:.:
  Fly    74 APQDSFRRPIRGELVTVNFTGKLDNGTVVENELN----FQCHVGDYEVIQGLDMVLPMLQVGEVS 134

Human    74 KLTISPDYAYGATG------HPGIIPPHATLVFDVELLKLE 108
            ::::...:.||:.|      ...::||.|.|.:::|||.::
  Fly   135 QVSVDSRFGYGSLGLKKEGESEYLVPPDAHLTYEIELLDIK 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FKBP1ANP_000792.1 FkpA 3..106 CDD:440311 27/102 (26%)
zdaNP_611353.1 FKBP_C 80..172 CDD:459735 24/95 (25%)
Spy 196..>338 CDD:443119
TPR repeat 196..220 CDD:276809
TPR repeat 252..282 CDD:276809
TPR repeat 287..313 CDD:276809
TPR repeat 321..349 CDD:276809
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.