DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zfy2 and CG2889

DIOPT Version :9

Sequence 1:NP_033597.2 Gene:Zfy2 / 22768 MGIID:99213 Length:777 Species:Mus musculus
Sequence 2:NP_001245615.1 Gene:CG2889 / 31977 FlyBaseID:FBgn0030206 Length:581 Species:Drosophila melanogaster


Alignment Length:718 Identity:156/718 - (21%)
Similarity:242/718 - (33%) Gaps:223/718 - (31%)


- Green bases have known domain annotations that are detailed below.


Mouse    80 LEETDISDNVIIPEQVLDLDTAEEVSL----AQFLIPDILTSSITSTSLTMPEHVLMSEAIHVSN 140
            |.|||              ||..|..|    |:||..:||.....|||      |......|:.:
  Fly    18 LFETD--------------DTLAETRLVKMIAKFLQLEILPDDGISTS------VCTECCEHLED 62

Mouse   141 VGHFEQVIHDS--LVEREIITDPLTADISDILVADWASEAVLDSS--GMPLEQQDDARINCEDYL 201
            ...|.|::...  .:::|.    ||.|: |.....|.....:|.:  .:||...|          
  Fly    63 FNGFWQLVEQKQCSLKKEF----LTVDV-DCAAMKWTGGVDVDVNIDELPLAAGD---------- 112

Mouse   202 MMSLDEPSKTDHEGS---SEVTMNAESETDSSKLDEASPEVIKVCILKADSEVDDVGETIQAVES 263
               :||.....|..|   |.:.:|.:|......:.|..|     |     .|.:|....:||.:|
  Fly   113 ---MDEKPLDLHNLSLLGSVLDVNVDSVEVREPIKEQLP-----C-----EEEEDEKPCLQASDS 164

Mouse   264 ETDNGNEAEVTDQRTSIHVPRVNIYMLASDSQKEEEDTKVIVGDEDAGGTAADTPEHEQQMDVSE 328
                  |.|||:.:              .:|:.:..|.:.:|                      .
  Fly   165 ------EPEVTEGQ--------------PESESDSSDDEPLV----------------------R 187

Mouse   329 IKAAFLPIAWTAAYDN-NSDEIEVQNATASAMLHHDESGGLDRVPKQKSKKKKRPESKQYQSAIF 392
            :|:...|...|:|..: :...|.:|...|..:    :.||         |:::|.          
  Fly   188 LKSKMKPKRKTSARSSKDQGPISLQQELADLL----DDGG---------KRRRRK---------- 229

Mouse   393 VAPDGQTLRVYPCMFCGKKFKTKRFLKRHIKNHPEYLANKKYHCTECDYSTNKKISLHNHMESHK 457
             |||.:|                                    .||             ..||..
  Fly   230 -APDQRT------------------------------------TTE-------------SQESEL 244

Mouse   458 LTIKTEKTTECDDCRKNLSHAGTMHTEKGVNK--TCKCKFCDYETAEQTLLNHHLLVVHRKKFPH 520
            ..:...|...|...:...|:      ||.:..  :..|..|::.....:.|..|.|.||::::..
  Fly   245 QAVLERKPKGCSRAQLAKSY------EKAIASYMSASCDLCEFSAPYLSELKTHFLEVHQREYYI 303

Mouse   521 ICGECGKGFRHPSALKKHIRVHTGEKPYECQYCEYKSADSSN-LKTHIKSKHS------KEIPLK 578
            .|  |||.|...|.|..|||.|...|.:.|..|: ||.:|.: |.|||::.|:      |.:...
  Fly   304 KC--CGKVFTRASKLMDHIRKHINPKLFTCTICK-KSLNSQDYLATHIETVHNKVAQIGKVLKFP 365

Mouse   579 CGICLLTFSDTKEAQQHAVLHQ-ESRTHQCSHCNHKSSNSSDLKRHIISVHTKAYPHKCDMCSKG 642
            |..|..|||..:....|...|. :...|.|..|....:|...|:|||.|:|...:.|.||:|.|.
  Fly   366 CPKCERTFSSERRMANHLAKHDTDQLEHTCEICCKSFANVHRLRRHIQSIHEDLHRHVCDICGKK 430

Mouse   643 FHRPSELKKHVATHK--------------------SKKMHQ---------CRHCDFKSPDPFLLS 678
            |......::|:..|:                    |.::|:         |.||.........|.
  Fly   431 FKFKPSFERHLLEHQGVVAPAVECPICRVWLKNEHSLRLHRFTHDSTDTVCPHCGKTCTSRTALR 495

Mouse   679 HHILSAHTKNVPFKCKRCKKEFQQQCELQTHMKTHSSRKVYQCEYCEYSTKDASGFKRHVISIHT 743
            .|:..||......:|..|:|.|:||..|..||..|:..::|.|.:|....:..|....|:...|.
  Fly   496 GHVKYAHKLTTNLQCTFCEKTFKQQRNLDEHMAIHTGLQLYNCPHCPKECRSRSNMYVHIKQRHA 560

Mouse   744 KDY 746
            .::
  Fly   561 DEW 563

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zfy2NP_033597.2 Zfx_Zfy_act 68..388 CDD:282547 63/319 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 207..234 6/29 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 361..389 4/27 (15%)
Nuclear localization signal. /evidence=ECO:0000255 372..382 1/9 (11%)
C2H2 Zn finger 405..425 CDD:275370 0/19 (0%)
C2H2 Zn finger 436..456 CDD:275368 3/19 (16%)
COG5048 <442..681 CDD:227381 68/277 (25%)
C2H2 Zn finger 493..514 CDD:275368 5/20 (25%)
zf-C2H2 520..542 CDD:278523 10/21 (48%)
C2H2 Zn finger 522..542 CDD:275368 10/19 (53%)
zf-H2C2_2 534..556 CDD:290200 8/21 (38%)
C2H2 Zn finger 550..571 CDD:275368 9/21 (43%)
C2H2 Zn finger 579..599 CDD:275368 6/19 (32%)
C2H2 Zn finger 607..628 CDD:275368 8/20 (40%)
C2H2 Zn finger 636..685 CDD:275368 14/77 (18%)
C2H2 Zn finger 693..713 CDD:275368 9/19 (47%)
C2H2 Zn finger 721..742 CDD:275368 4/20 (20%)
C2H2 Zn finger 750..770 CDD:275368
CG2889NP_001245615.1 zf-AD 2..79 CDD:285071 20/80 (25%)
C2H2 Zn finger 276..297 CDD:275368 5/20 (25%)
C2H2 Zn finger 306..323 CDD:275368 9/16 (56%)
C2H2 Zn finger 331..352 CDD:275368 9/21 (43%)
C2H2 Zn finger 366..386 CDD:275368 6/19 (32%)
C2H2 Zn finger 395..416 CDD:275368 8/20 (40%)
C2H2 Zn finger 424..444 CDD:275368 6/19 (32%)
C2H2 Zn finger 481..502 CDD:275368 5/20 (25%)
C2H2 Zn finger 510..530 CDD:275368 9/19 (47%)
C2H2 Zn finger 538..556 CDD:275368 4/17 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.