DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zfx and CG1647

DIOPT Version :9

Sequence 1:XP_006528028.1 Gene:Zfx / 22764 MGIID:99211 Length:832 Species:Mus musculus
Sequence 2:NP_651636.1 Gene:CG1647 / 43401 FlyBaseID:FBgn0039602 Length:1222 Species:Drosophila melanogaster


Alignment Length:289 Identity:63/289 - (21%)
Similarity:98/289 - (33%) Gaps:57/289 - (19%)


- Green bases have known domain annotations that are detailed below.


Mouse   573 FPHICVECGKGFRH--------PSELKKHMRIHTGEKPYE---CQYCEYRSADSS-----NLKTH 621
            |..:|....|..|:        |:.|....||...|:|..   .:....|..:.|     |:|..
  Fly    85 FREMCYATNKQTRNLLGLKQIEPARLIDLKRIVKEERPISGAVGKRGRKRKGEESWPKNNNVKPQ 149

Mouse   622 VKTK----HSKEMPFKCDICLLTFSDTKEVQQHALVHQES---------KTHQCLHCDHKSSNSS 673
            ||.:    |.|:......|..|......|::........|         :...|..|..|..:..
  Fly   150 VKKESFVWHKKQKLQPSQITSLVSKREPEIKDEPAEQDTSLKGPPKKAGRKSICSVCGEKFLSKE 214

Mouse   674 DLKRHIISVHTKDYP-HKCDMCDKGFHRPSELKKHVAAHK-GKKMHQCRHCDFKIADPFVLSRHI 736
            ....|...||....| :.|:.|::..|..|:::.|...|| .|..::|..|:..:|:.:..:|| 
  Fly   215 LADEHKSLVHVPSIPRYICNACNQTHHNQSDIRAHQLWHKLSKTPYKCPLCESSVANAYAFTRH- 278

Mouse   737 LSVHTKDLPFR-------CKRCRKGFRQQSELKKHMKTHSGRKVYQCEYCEYSTTDASGFKRHVI 794
            |..||...|.:       |..|:|.|........|......||   |..|..:....:.:.||..
  Fly   279 LREHTPPTPVQLLVLDRECPLCKKTFVTNFFYNTHRCAIRKRK---CGGCSRTLNTEAAYMRHAP 340

Mouse   795 SIHTKDYPHRCEYCKKGFRRPSEKNQHIM 823
            :            |.|.:...|   :|||
  Fly   341 T------------CPKIYLNHS---KHIM 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZfxXP_006528028.1 Zfx_Zfy_act 104..437 CDD:368066
zf-C2H2 452..474 CDD:333835
C2H2 Zn finger 454..474 CDD:275368
C2H2 Zn finger 485..509 CDD:275368
C2H2 Zn finger 517..537 CDD:275368
COG5048 570..>832 CDD:227381 63/289 (22%)
C2H2 Zn finger 577..597 CDD:275368 6/27 (22%)
C2H2 Zn finger 605..624 CDD:275368 5/23 (22%)
C2H2 Zn finger 662..683 CDD:275368 4/20 (20%)
C2H2 Zn finger 691..711 CDD:275368 5/19 (26%)
C2H2 Zn finger 748..768 CDD:275368 5/19 (26%)
C2H2 Zn finger 776..797 CDD:275368 4/20 (20%)
C2H2 Zn finger 805..825 CDD:275368 6/19 (32%)
CG1647NP_651636.1 zf-AD 19..99 CDD:285071 4/13 (31%)
C2H2 Zn finger 203..224 CDD:275368 4/20 (20%)
C2H2 Zn finger 233..253 CDD:275368 5/19 (26%)
C2H2 Zn finger 262..282 CDD:275368 6/20 (30%)
C2H2 Zn finger 297..314 CDD:275368 4/16 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24406
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.