DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zfp93 and M1BP

DIOPT Version :9

Sequence 1:NP_001347156.1 Gene:Zfp93 / 22755 MGIID:107611 Length:663 Species:Mus musculus
Sequence 2:NP_649825.1 Gene:M1BP / 41042 FlyBaseID:FBgn0037621 Length:418 Species:Drosophila melanogaster


Alignment Length:158 Identity:62/158 - (39%)
Similarity:84/158 - (53%) Gaps:9/158 - (5%)


- Green bases have known domain annotations that are detailed below.


Mouse   289 SVPIQPSVH--PGRKR-----YWCHECGKGFRQSSALQTHQRVHTGEKPYRCDSCGKGFSRSSDL 346
            |:|.:|.|.  ..|:|     |.|.:||...:...|.:.|.|.|.|:|.:.|:.|...|..:|:|
  Fly   230 SLPPKPKVRSDDARRRGTGGVYICEQCGNHIKGRMAFELHCRRHRGDKQFGCELCQSRFCTTSEL 294

Mouse   347 NIHRRVHTGEKPYKCEVCGKGFTQWAHLQAHERIHTGEKPYKCGDCGKRFSCSSNLHTHQRVHTE 411
            ..|.|.||||:|:.|:.||:.||.:.....|||.||.|:||.||.|||.|:....|..|..:|:.
  Fly   295 KRHMRKHTGERPFACKYCGRCFTDYTTRVKHERTHTNERPYVCGTCGKAFTTGYILKNHMLIHSG 359

Mouse   412 EKPYECNECGKRFSLSGNLDIHQR--VH 437
            |:.|.|..|.|.|.|..:|..|.|  ||
  Fly   360 ERAYRCELCDKSFMLPTHLSTHFRSGVH 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zfp93NP_001347156.1 KRAB 25..66 CDD:307490
COG5048 275..>613 CDD:227381 62/158 (39%)
C2H2 Zn finger 305..325 CDD:275368 6/19 (32%)
C2H2 Zn finger 333..353 CDD:275368 7/19 (37%)
C2H2 Zn finger 361..381 CDD:275368 8/19 (42%)
C2H2 Zn finger 389..409 CDD:275368 8/19 (42%)
C2H2 Zn finger 417..437 CDD:275368 8/21 (38%)
C2H2 Zn finger 445..465 CDD:275368
C2H2 Zn finger 473..493 CDD:275368
C2H2 Zn finger 501..521 CDD:275368
C2H2 Zn finger 529..549 CDD:275368
C2H2 Zn finger 557..577 CDD:275368
C2H2 Zn finger 585..605 CDD:275368
C2H2 Zn finger 613..633 CDD:275368
C2H2 Zn finger 641..661 CDD:275368
M1BPNP_649825.1 zf-AD 13..84 CDD:214871
C2H2 Zn finger 253..273 CDD:275368 6/19 (32%)
COG5048 276..>331 CDD:227381 22/54 (41%)
C2H2 Zn finger 281..301 CDD:275368 7/19 (37%)
zf-H2C2_2 293..317 CDD:290200 11/23 (48%)
C2H2 Zn finger 309..329 CDD:275368 8/19 (42%)
zf-H2C2_2 324..346 CDD:290200 14/21 (67%)
C2H2 Zn finger 337..357 CDD:275368 8/19 (42%)
zf-H2C2_2 350..372 CDD:290200 8/21 (38%)
C2H2 Zn finger 365..383 CDD:275368 7/17 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.