DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FHL2 and CG31988

DIOPT Version :10

Sequence 1:NP_001441.4 Gene:FHL2 / 2274 HGNCID:3703 Length:279 Species:Homo sapiens
Sequence 2:NP_610098.1 Gene:CG31988 / 326182 FlyBaseID:FBgn0051988 Length:178 Species:Drosophila melanogaster


Alignment Length:177 Identity:58/177 - (32%)
Similarity:89/177 - (50%) Gaps:9/177 - (5%)


- Green bases have known domain annotations that are detailed below.


Human   101 CQECKKTIMPGTRKM-EYKGSSWHETCFICHRCQQPIGTKSFIPKDNQNFCVPCYEKQHAMQCVQ 164
            |.:|::.|   |::| ...|.:||...|:||.|.:.|...:|..:..:..|..|:.:::...|..
  Fly     7 CHKCQEAI---TKRMITALGKTWHPEHFLCHHCDEQILDATFNVQSGEPVCNKCFVERYTYTCAG 68

Human   165 CKKPITTGGVTYREQPWHKECFVC-TACRKQLSGQRFTARDDFAYCLNCFCDLYAKKCAGCTNPI 228
            |||||....:....:.||::||.| .||:|.|:.|.|..||...||...:.||:|.:||.|..||
  Fly    69 CKKPILEKTICAMGESWHEDCFCCGGACKKPLANQTFYERDGKPYCKKDYEDLFAARCAKCEKPI 133

Human   229 SGLGGTKYISFEERQWHNDCFNCKKCSLSLVGRGFLTERDDILCPDC 275
            :    ...:.....:||.|||.|.||...:..:.|..:.|..:||.|
  Fly   134 T----DSAVLAMNVKWHRDCFRCNKCENPITSQTFTIDGDKPVCPAC 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FHL2NP_001441.4 LIM <5..33 CDD:413332
LIM1_FHL2 36..97 CDD:188806
LIM2_FHL2 101..157 CDD:188810 16/56 (29%)
LIM3_Fhl2 162..218 CDD:188815 23/56 (41%)
LIM4_FHL2 221..278 CDD:188817 18/55 (33%)
CG31988NP_610098.1 LIM 126..176 CDD:259829 17/53 (32%)
LIM 7..58 CDD:413332 15/53 (28%)
LIM 66..118 CDD:413332 21/51 (41%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.