DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zbtb7b and CG31365

DIOPT Version :9

Sequence 1:NP_001342135.1 Gene:Zbtb7b / 22724 MGIID:102755 Length:607 Species:Mus musculus
Sequence 2:NP_732827.1 Gene:CG31365 / 42736 FlyBaseID:FBgn0051365 Length:639 Species:Drosophila melanogaster


Alignment Length:379 Identity:89/379 - (23%)
Similarity:136/379 - (35%) Gaps:92/379 - (24%)


- Green bases have known domain annotations that are detailed below.


Mouse   226 LEAFATATTTASTSGMPNGE-DSPPQVPLLPPPPPPPRPVARRSRKPRKAFLQTKGARANHLVPE 289
            ||.:.|.........:...| ::.|||. ....|...:..|...|:|.......|...|.....|
  Fly   214 LEVYLTEKKAGRWESLDGSEPETKPQVK-EDASPSRSKTKALPKRRPSLVDANLKATEARKDAKE 277

Mouse   290 APTVL---THPLTYEEEEMVG-RLGNSGGSGLGDSYSPPTGAASPAEGPLNYEVF----EGEEEE 346
            ...:|   |.|....:..:.| .|.....:..|:.:.......|......|.|::    ...|::
  Fly   278 EEFILGCNTDPANNSDVNIDGLELDEEVPAESGEDFREINMVGSDVVHTDNGEIYIINSASSEDQ 342

Mouse   347 EEMAYP--------PGYGLAQSNEPSLS---PEELGSDEDPIDPDLMAYLS------SLHQDAL- 393
            .:.:.|        ..|.:.:..|...|   |||:   ||.:..:|...:|      |.|::.: 
  Fly   343 NQDSTPEFDQDNGITSYNIKEDGEIQFSGEKPEEI---EDVVVFNLGEEISQEQQVFSFHENVII 404

Mouse   394 ----TPGLDGQDKLVRKRRSQM--------PQ--------------------------------- 413
                ....|.|..|.|||.|::        ||                                 
  Fly   405 VEKEQNDRDEQTPLKRKRSSELVFKQESSCPQPKTGRITDTVKSFQCHLCPVAFPTQKLLTRHHN 469

Mouse   414 --------------ECPVCHKIIHGAGKLPRHMRTHTGEKPFACEVCGVRFTRNDKLKIHMRKHT 464
                          :||.|...:..|..|.|||..|||.|||.|..|.:.|::.:.||.||..||
  Fly   470 THIKGLKSGKGGTLKCPSCALQLSCASSLKRHMIIHTGLKPFKCSECELSFSQREVLKRHMDTHT 534

Mouse   465 GERPYSCPHCPARFLHSYDLKNHM-HLHTGD-RPYECHLCHKAFAKEDHLQRHL 516
            |.:.:.||.|.:.|....:|:.|: .:|.|: |.::|||||::|.....|.|||
  Fly   535 GVKRHQCPQCSSCFAQKSNLQQHIGRVHMGNSRTHKCHLCHRSFNHVSGLSRHL 588

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zbtb7bNP_001342135.1 BTB 87..207 CDD:306997
COG5048 412..>491 CDD:227381 32/126 (25%)
C2H2 Zn finger 415..435 CDD:275368 8/19 (42%)
zf-H2C2_2 430..452 CDD:316026 12/21 (57%)
C2H2 Zn finger 443..463 CDD:275368 7/19 (37%)
C2H2 Zn finger 471..491 CDD:275368 6/20 (30%)
zf-H2C2_2 483..508 CDD:316026 11/26 (42%)
C2H2 Zn finger 499..517 CDD:275368 10/18 (56%)
CG31365NP_732827.1 zf-AD 13..86 CDD:214871
vATP-synt_E 109..>244 CDD:304907 7/30 (23%)
RRF <161..222 CDD:294170 3/7 (43%)
zf-C2H2_8 454..530 CDD:292531 19/75 (25%)
C2H2 Zn finger 485..505 CDD:275368 8/19 (42%)
zf-H2C2_2 497..522 CDD:290200 13/24 (54%)
C2H2 Zn finger 513..533 CDD:275368 7/19 (37%)
zf-H2C2_2 526..550 CDD:290200 11/23 (48%)
C2H2 Zn finger 541..562 CDD:275368 6/20 (30%)
C2H2 Zn finger 571..591 CDD:275368 10/18 (56%)
C2H2 Zn finger 598..617 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.