DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zfp239 and CG4854

DIOPT Version :9

Sequence 1:NP_001001792.1 Gene:Zfp239 / 22685 MGIID:1306812 Length:201 Species:Mus musculus
Sequence 2:NP_650860.1 Gene:CG4854 / 42391 FlyBaseID:FBgn0038766 Length:319 Species:Drosophila melanogaster


Alignment Length:145 Identity:59/145 - (40%)
Similarity:81/145 - (55%) Gaps:6/145 - (4%)


- Green bases have known domain annotations that are detailed below.


Mouse    34 FKCDRCGKGFSQSSKLHIHKRVHTGEKPYACEECGMSFSQRSNLHIHQRVHTGERPYKCGECGKG 98
            |.|:.|...:|:..||..|.:||:.:||:.||.|...|.|...|..|...|||.|||||..|...
  Fly   178 FTCNICNNVYSERVKLTNHMKVHSAKKPHECEICHKRFRQTPQLARHMNTHTGNRPYKCDYCDSR 242

Mouse    99 FSQSSNLHIHRCTHTGEKPYQCYECGKGFSQSSDLRIHLRVHTGEKPYHCGKCGQGFSQSSKLLI 163
            |:..|....|:..||.|:||:|..|.:.|..|:.||:||:.||||:|:.|..|.:.|||    |.
  Fly   243 FADPSTRIKHQRIHTNERPYKCEFCSRSFGYSNVLRVHLKTHTGERPFSCQYCQKSFSQ----LH 303

Mouse   164 HQRVHTGEKPYECSK 178
            |:..|  ||.::.:|
  Fly   304 HKNSH--EKSHKRTK 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zfp239NP_001001792.1 COG5048 <4..148 CDD:227381 48/113 (42%)
C2H2 Zn finger 8..28 CDD:275368
C2H2 Zn finger 36..56 CDD:275368 6/19 (32%)
C2H2 Zn finger 64..84 CDD:275368 7/19 (37%)
C2H2 Zn finger 92..112 CDD:275368 5/19 (26%)
SFP1 <114..201 CDD:227516 27/65 (42%)
C2H2 Zn finger 120..140 CDD:275368 8/19 (42%)
C2H2 Zn finger 148..168 CDD:275368 7/19 (37%)
C2H2 Zn finger 176..196 CDD:275368 1/3 (33%)
CG4854NP_650860.1 zf-AD 12..>57 CDD:285071
C2H2 Zn finger 180..200 CDD:275368 6/19 (32%)
zf-H2C2_2 193..217 CDD:290200 10/23 (43%)
COG5048 201..>258 CDD:227381 22/56 (39%)
C2H2 Zn finger 208..228 CDD:275368 7/19 (37%)
zf-H2C2_2 221..244 CDD:290200 11/22 (50%)
C2H2 Zn finger 236..256 CDD:275368 5/19 (26%)
zf-H2C2_2 251..273 CDD:290200 9/21 (43%)
C2H2 Zn finger 264..284 CDD:275368 8/19 (42%)
zf-H2C2_2 277..301 CDD:290200 12/23 (52%)
C2H2 Zn finger 292..312 CDD:275368 10/25 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 140 1.000 Inparanoid score I4481
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.