DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Zfand5 and Rabex-5

DIOPT Version :9

Sequence 1:	NP_033577.1	Gene:	Zfand5 / 22682	MGIID:	1278334	Length:	213	Species:	Mus musculus
Sequence 2:	NP_612093.1	Gene:	Rabex-5 / 38144	FlyBaseID:	FBgn0262937	Length:	696	Species:	Drosophila melanogaster

Alignment Length:	130	Identity:	35/130 - (26%)
Similarity:	55/130 - (42%)	Gaps:	19/130 - (14%)

- Green bases have known domain annotations that are detailed below.

Mouse    14 CSTGCGFYGNPRTNGMCSVCYKEHLQRQQNSGRMSPMGTASGSNS--PTSDSASVQRADAGLNNC 76
            |.:||||||.|:..|:||:|::|....:|...:.:...|..||:|  .|.|..|.|.|.
  Fly    19 CRSGCGFYGTPQNEGLCSMCFREKFNDKQRKLKQTGGETGPGSSSSVATLDRRSPQHAH------ 77

Mouse    77 EGAAGSTSEKSRNVPVAALPVTQQMTEMSISREDKITT--PKT-EVSEPVVTQPSPSVSQPSSSQ 138
              ..|...::.|.      |..::...:...::.|.|.  .|| :.....:||....|..|:..|
  Fly    78 --LQGKVEQQVRK------PSDKEQDNLGTLQKKKFTAVLQKTLQAGAQKITQQRGHVPDPTEGQ 134

Mouse 139 138
Fly 135 134

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Zfand5	NP_033577.1	zf-A20	12..35	CDD:366793	12/20 (60%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	39..149		22/105 (21%)
		ZnF_AN1	154..191	CDD:197545
Rabex-5	NP_612093.1	zf-A20	17..40	CDD:280010	12/20 (60%)
Rabex-5	NP_612093.1	VPS9	274..373	CDD:280383
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG3173
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900