DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FGR and PIN3

DIOPT Version :9

Sequence 1:NP_001036194.1 Gene:FGR / 2268 HGNCID:3697 Length:529 Species:Homo sapiens
Sequence 2:NP_015480.1 Gene:PIN3 / 856277 SGDID:S000006358 Length:215 Species:Saccharomyces cerevisiae


Alignment Length:67 Identity:20/67 - (29%)
Similarity:33/67 - (49%) Gaps:2/67 - (2%)


- Green bases have known domain annotations that are detailed below.


Human    72 RGVSGIGVTLFIALYDYEARTEDDLTFTKGEKFHILNNTEGDWWEARSLSSGKTGCIPSNYVAPV 136
            |..|...:....|||.::.:.:.||....|:|..:|.....:|:  :...:|:||..|:|||.|.
Yeast    49 RNASPASLEYVEALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWY--KGSCNGRTGIFPANYVKPA 111

Human   137 DS 138
            .|
Yeast   112 FS 113

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FGRNP_001036194.1 SH3 80..137 CDD:327375 17/56 (30%)
SH2_Src_Fgr 140..240 CDD:198230
PKc_like 267..514 CDD:328722
PIN3NP_015480.1 SH3 58..110 CDD:418401 16/53 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000006
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.