DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FGR and SLA1

DIOPT Version :9

Sequence 1:NP_001036194.1 Gene:FGR / 2268 HGNCID:3697 Length:529 Species:Homo sapiens
Sequence 2:NP_009546.1 Gene:SLA1 / 852276 SGDID:S000000103 Length:1244 Species:Saccharomyces cerevisiae


Alignment Length:116 Identity:35/116 - (30%)
Similarity:58/116 - (50%) Gaps:12/116 - (10%)


- Green bases have known domain annotations that are detailed below.


Human    83 IALYDYEARTEDDLTFTKGEKFHILNNTEG-DWWEARSLSSGKTGCIPSNYVAPV-DSIQAEEWY 145
            |..||:.|.::|:||...|:|.:||::.:. |||..:.:.|||:|.:|:.::.|| |....|...
Yeast   359 IVQYDFMAESQDELTIKSGDKVYILDDKKSKDWWMCQLVDSGKSGLVPAQFIEP
VRDKKHTESTA 423

Human   146 FGKIGRKDAERQLL-SPGNPQGAFLIRESETTKGAYSLSIRDWDQTRGDHV 195
            .|.|  |..::... ||...      |....:|...:.|.:| |:.:.|.|
Yeast   424 SGII--KSIKKNFTKSPSRS------RSRSRSKSNANASWKD-DELQNDVV 465

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FGRNP_001036194.1 SH3 80..137 CDD:327375 21/55 (38%)
SH2_Src_Fgr 140..240 CDD:198230 13/57 (23%)
PKc_like 267..514 CDD:328722
SLA1NP_009546.1 SH3_Sla1p_1 7..64 CDD:212707
SH3 73..127 CDD:327375
SH3_Sla1p_3 356..412 CDD:212709 19/52 (37%)
SHD1 489..554 CDD:309199
SAM_SLA1_fungal 655..716 CDD:188931
MotB_plug <738..848 CDD:330912
Med15 831..>1201 CDD:312941
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 47 1.000 Domainoid score I3374
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.