DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FGR and wnd

DIOPT Version :9

Sequence 1:NP_001036194.1 Gene:FGR / 2268 HGNCID:3697 Length:529 Species:Homo sapiens
Sequence 2:NP_649137.3 Gene:wnd / 40143 FlyBaseID:FBgn0036896 Length:977 Species:Drosophila melanogaster


Alignment Length:304 Identity:89/304 - (29%)
Similarity:143/304 - (47%) Gaps:43/304 - (14%)


- Green bases have known domain annotations that are detailed below.


Human   244 MKPQTLGLAK-----------DAWEISRSSITLERRLGTGCFGDVWLGTWNGSTKVAVKTLKPGT 297
            |||....:.|           :.|:|...|||....||:|..|.|:.|.....| ||||.:|.  
  Fly   131 MKPVLSFIGKTGVIEVKSQRSEDWQIPFESITELEWLGSGAQGAVFSGRLKNET-VAVKKVKE-- 192

Human   298 MSPKAFLEEAQV--MKLLRHDKLVQLYAVVSEEPIY-IVTEFMCHGSLLDFLKNPEGQDLRLP-Q 358
                  |:|..:  ::.|.|:.:::...|.::.|:: |:.||..:|.|.:.||.   :.:.|| :
  Fly   193 ------LKETDIKHLRKLDHENIIKFKGVCTQSPVFCIIMEFCPYGPLQNILKE---EQVMLPSR 248

Human   359 LVDMAAQVAEGMAYMERMNYIHRDLRAANILVGERLACKIADFGLARLIKDDEYNPCQGSKF--- 420
            ||..:.|:|.||.|:.....|||||::.|||:......||:|||.:|     |:|.. .:|.   
  Fly   249 LVSWSKQIALGMQYLHSHKIIHRDLKSPNILISTNEVVKISDFGTSR-----EWNEI-STKMSFA 307

Human   421 -PIKWTAPEAALFGRFTIKSDVWSFGILLTELITKGRIPYPGMNKREVLEQV-EQGYHMPCPPGC 483
             .:.|.|||.......:.|.|:||:|::|.|::| ..|||..::...::..| .....:..|..|
  Fly   308 GTVAWMAPEVIRNEPCSEKVDIWSYGVVLWEMLT-CEIPYKDVDSSAIIWGVGNNSLKLLVPSTC 371

Human   484 PASLYEAMEQTWRLDPEERPTFEYLQSFLE----DYFTSAEPQY 523
            |......::..|:..|..||:|..:.|.|:    :.....|.||
  Fly   372 PEGFKLLVKLCWKSKPRNRPSFRQILSHLDIAGPELLRKTEKQY 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FGRNP_001036194.1 SH3 80..137 CDD:327375
SH2_Src_Fgr 140..240 CDD:198230
PKc_like 267..514 CDD:328722 77/259 (30%)
wndNP_649137.3 STYKc 161..400 CDD:214568 78/257 (30%)
STKc_MAP3K12_13 167..403 CDD:270961 77/254 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.