DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FGL1 and CG9500

DIOPT Version :9

Sequence 1:NP_004458.3 Gene:FGL1 / 2267 HGNCID:3695 Length:312 Species:Homo sapiens
Sequence 2:NP_609018.3 Gene:CG9500 / 33888 FlyBaseID:FBgn0031804 Length:292 Species:Drosophila melanogaster


Alignment Length:273 Identity:92/273 - (33%)
Similarity:127/273 - (46%) Gaps:56/273 - (20%)


- Green bases have known domain annotations that are detailed below.


Human    54 LLQENEVQFLDKGDENTVIDLGSKRQYADCSEIFNDGYKLSGFYKIK-PLQSPAE---------- 107
            ||:||:.....:..:.:..||.:.              .|||.|..: |...||.          
  Fly    48 LLEENQSNASTENIQKSSSDLNTT--------------GLSGRYPSQCPTYPPAHGIYTVQVLGL 98

Human   108 --FSVYCDMSDGG-GWTVIQRRSDGSENFNRGWKDYENGFGNFVQKHGEYWLGNKNLHFLTTQED 169
              |.|.||....| ||||:.||:....||.|.|.:|:||||   |..|::::|...||.:|..:.
  Fly    99 KPFQVSCDAEIAGTGWTVMARRTSNKLNFFRSWAEYKNGFG---QLDGDFFIGLDKLHAITKSQP 160

Human   170 YTLKIDLADFEKNSRYAQYKNFKVGDEKNFYEL-NIGEYSGTAGDSLAGNFHPEVQWWASHQRMK 233
            :.|.|.|.|||..:|||.|....:..|..||.: .:||::|.||||:..|           :...
  Fly   161 HELYIHLEDFEGQTRYAHYDEIFIESENKFYAMTKLGEFTGDAGDSMIHN-----------RNQN 214

Human   234 FSTWDRDHDNYEGNCAEEDQSGWWFNRCHSANLNGVYYSGPYTAKTD-------NGIVWYTWHGW 291
            |||:|||:|.:..|||||....||...|..:||.|:|..|      |       .||||::|...
  Fly   215 FSTFDRDNDGWHKNCAEEYVGAWWHLNCTYSNLFGIYVKG------DEGQYFQWKGIVWHSWRTE 273

Human   292 WYSLKSVVMKIRP 304
            .||.|.:.|.:||
  Fly   274 SYSYKVMQMMVRP 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FGL1NP_004458.3 FReD 78..304 CDD:238040 84/247 (34%)
CG9500NP_609018.3 FReD 76..287 CDD:238040 83/231 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 186 1.000 Domainoid score I3350
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm40314
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.