DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FGL1 and CG31832

DIOPT Version :9

Sequence 1:NP_004458.3 Gene:FGL1 / 2267 HGNCID:3695 Length:312 Species:Homo sapiens
Sequence 2:NP_723894.2 Gene:CG31832 / 318970 FlyBaseID:FBgn0051832 Length:227 Species:Drosophila melanogaster


Alignment Length:212 Identity:83/212 - (39%)
Similarity:115/212 - (54%) Gaps:20/212 - (9%)


- Green bases have known domain annotations that are detailed below.


Human    99 IKPLQSPAE--FSVYCDMSDGGGWTVIQRRSDGSENFNRGWKDYENGFGNFVQKHGEYWLGNKNL 161
            |..|..|.|  |.|....:....|.|||||.|||.|||:.|..|::|||:   .:||:::|.:.|
  Fly    33 IHQLMLPEEEPFQVTQCKTTARDWIVIQRRLDGSVNFNQSWFSYKDGFGD---PNGEFFIGLQKL 94

Human   162 HFLTTQEDYTLKIDLADFEKNSRYAQYKNFKVGDEKNFYEL-NIGEYSGTAGDSLAGNFHPEVQW 225
            :.:|.::.:.|.|.|......:.||.:.:|:|..|...|:| .:|:|||||||||          
  Fly    95 YLMTREQPHELFIQLKHGPGATVYAHFDDFQVDSETELYKLERVGKYSGTAGDSL---------- 149

Human   226 WASHQRMKFSTWDRDHDNYEGNCAEEDQSGWWFNRCHSANLNGVYYSGPYTAKTDNGIVWYTWHG 290
             ..|...:|||:|||:|....|||.|...||||:.|.|::|||:|:....|... |||.|..|. 
  Fly   150 -RYHINKRFSTFDRDNDESSKNCAAEHGGGWWFHSCLSSSLNGLYFREGETGML-NGIHWGRWK- 211

Human   291 WWYSLKSVVMKIRPNDF 307
             :.||..|.:.|||..|
  Fly   212 -FQSLTFVQIMIRPKYF 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FGL1NP_004458.3 FReD 78..304 CDD:238040 80/207 (39%)
CG31832NP_723894.2 FReD 28..225 CDD:238040 81/208 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 168 1.000 Inparanoid score I4150
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48118
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.870

Return to query results.
Submit another query.