DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sf1 and qkr58E-3

DIOPT Version :9

Sequence 1:NP_001104261.1 Gene:Sf1 / 22668 MGIID:1095403 Length:639 Species:Mus musculus
Sequence 2:NP_001246460.1 Gene:qkr58E-3 / 37559 FlyBaseID:FBgn0022984 Length:317 Species:Drosophila melanogaster


Alignment Length:350 Identity:83/350 - (23%)
Similarity:134/350 - (38%) Gaps:89/350 - (25%)


- Green bases have known domain annotations that are detailed below.


Mouse    76 PEDRSPSPEPIYNSEGKRLNTREFRTRKKLEEERH----------TLITEMV------ALNPDFK 124
            |.:.:....|.::.: .|||....:....|:|||.          .||.|.|      ...|..:
  Fly     4 PSEFTEKQPPTHDHQ-PRLNEVAQKFLADLDEERQRLSADFPLCALLIDEAVDRVYCTGRIPGKE 67

Mouse   125 PPAD-YKPPATRVSDKVMIPQDEYPEINFVGLLIGPRGNTLKNIEKECNAKIMIRGKGSVKEGKV 188
            ..|| ||....:::.||.:|..:||:.||.|.::||:||:|:.:::|...||.|:|:.|:::   
  Fly    68 FYADVYKQKPMKITQKVFVPVKQYPKFNFTGKILGPKGNSLRRLQEETQCKIAIKGRSSIRD--- 129

Mouse   189 GRKDGQMLPGEDEPLHA-------------LVTANTMENVKKAVEQIRNILKQGIETPEDQNDLR 240
             |...:.|....:|.:|             ...|.....:..|:.:||..|     .|:..:::.
  Fly   130 -RNKEEQLRSTGDPRYAHLQKDLFLEVSTVATPAECYARIAYALAEIRKYL-----IPDKNDEVS 188

Mouse   241 KMQLRELARLNGTLREDDNRILRPWQSSETRSITNTTVCTKCGGAGHIASDCKFQRPGDPQSAQD 305
            ..|||||..::   .|....|..| .....||:.:    .|.||..:          |.|     
  Fly   189 HEQLRELMEMD---PESAKNIHGP-NLEAYRSVFD----KKFGGNSN----------GAP----- 230

Mouse   306 KARMDKEYLSLMAELGEAP--------VPASVGSTSGPATTPLA---SAPRPA-----APASNPP 354
                  :|::|:....|.|        |.........|...|..   |.|||:     |.|...|
  Fly   231 ------KYINLIKRAAENPPEVDDVEEVAYEYEHRMPPKRPPTGYEYSKPRPSIIPTNAAAYKRP 289

Mouse   355 PPSLMSTTQSRPPWMNSGPSENRPY 379
            .|:.|...: .||..:..|:   ||
  Fly   290 YPTDMKRMR-EPPIKSYKPN---PY 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sf1NP_001104261.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..44
Nuclear localization signal. /evidence=ECO:0000255 15..19
MSL5 17..257 CDD:227503 52/210 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 65..94 2/17 (12%)
ZnF_C2HC 278..293 CDD:197667 3/14 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 325..584 16/62 (26%)
qkr58E-3NP_001246460.1 SF1_like-KH 81..200 CDD:239088 34/130 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5176
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.731683 Normalized mean entropy S1317
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.760

Return to query results.
Submit another query.