DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zfp148 and CG4820

DIOPT Version :9

Sequence 1:XP_006522161.1 Gene:Zfp148 / 22661 MGIID:1332234 Length:800 Species:Mus musculus
Sequence 2:NP_001097748.1 Gene:CG4820 / 41344 FlyBaseID:FBgn0037876 Length:362 Species:Drosophila melanogaster


Alignment Length:279 Identity:72/279 - (25%)
Similarity:108/279 - (38%) Gaps:52/279 - (18%)


- Green bases have known domain annotations that are detailed below.


Mouse    56 EILAADEVLQESEMRQQDMISHDELMVHEETVKNDEEQMDTHE---------RLPQGLQYALNVP 111
            |..||.|.|:..:....|.:..||||...: :|.:..|:...|         :|.|.|.|. |.|
  Fly    86 EAPAAMEQLRVQQAAAPDPLGIDELMSASD-IKIEPIQLQMEEDPQAPYPENQLEQALSYG-NAP 148

Mouse   112 ----------ISVKQEITFTDVSEQLMRDKKQVREPVDLQKKKKRKQRSPAK------VRDCAKI 160
                      ....|....|..:|...|..|...:    .|.||...|...|      :.|....
  Fly   149 GEDILPLPEDYGEAQTEVATTTNEPAQRRSKNTAK----IKSKKHTMRVGRKLIHVKVIDDKQPK 209

Mouse   161 LTINEDGSLGLKTPKSHVCEHCNAAFRTNYHLQRHVFIHTGEKPFQCSQCDMRFIQKYLLQRHEK 225
            ..::.:|    .:.|..:||||...|:...:|..|:..|||.|||:|.||..:....:||:||:.
  Fly   210 RIVDRNG----PSAKPCICEHCGRQFKDTSNLHVHLLRHTGTKPFECDQCHQKCYTLHLLRRHQL 270

Mouse   226 IHTGEKPFRCDECGMRFIQKYHMERHKR---------------THSGEKPYQCEYCLQYFSRTDR 275
            .|| |.|:.|..||:.:.......||:|               ...||:.:.||.|..:|.|...
  Fly   271 KHT-EGPYACTFCGLEYSTNSSRVRHEREACKKGRAPQSKWEIIKKGERTFHCEVCDLWFLRAGN 334

Mouse   276 VLKH-KRMCHENHDKKLNR 293
            ..:| ....|..::::..|
  Fly   335 FTQHINSSSHIENERRKKR 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zfp148XP_006522161.1 zf-C2H2 177..199 CDD:333835 7/21 (33%)
C2H2 Zn finger 179..199 CDD:275368 7/19 (37%)
zf-H2C2_2 191..216 CDD:372612 11/24 (46%)
C2H2 Zn finger 207..227 CDD:275368 7/19 (37%)
zf-H2C2_2 220..244 CDD:372612 10/23 (43%)
C2H2 Zn finger 235..255 CDD:275368 6/34 (18%)
zf-H2C2_2 247..272 CDD:372612 9/39 (23%)
C2H2 Zn finger 263..281 CDD:275368 6/18 (33%)
CG4820NP_001097748.1 zf-AD 4..75 CDD:285071
C2H2 Zn finger 224..244 CDD:275368 7/19 (37%)
C2H2 Zn finger 252..272 CDD:275368 7/19 (37%)
C2H2 Zn finger 279..297 CDD:275368 5/17 (29%)
C2H2 Zn finger 322..339 CDD:275368 5/16 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S4895
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.