DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FGG and CG31832

DIOPT Version :9

Sequence 1:NP_068656.2 Gene:FGG / 2266 HGNCID:3694 Length:453 Species:Homo sapiens
Sequence 2:NP_723894.2 Gene:CG31832 / 318970 FlyBaseID:FBgn0051832 Length:227 Species:Drosophila melanogaster


Alignment Length:221 Identity:73/221 - (33%)
Similarity:109/221 - (49%) Gaps:34/221 - (15%)


- Green bases have known domain annotations that are detailed below.


Human   179 CQDIANKGAKQSGLYFIKPLKANQQFLVYCEIDGSGNGWTVFQKRLDGSVDFKKNWIQYKEGFGH 243
            |...:..|..|..|...:|.:..|     |:.  :...|.|.|:||||||:|.::|..||:||| 
  Fly    25 CPSGSPNGIHQLMLPEEEPFQVTQ-----CKT--TARDWIVIQRRLDGSVNFNQSWFSYKDGFG- 81

Human   244 LSPTGTTEFWLGNEKIHLISTQSAIPYALRVELEDWNGRTSTADYAMFKVGPEADKYRLTYAYFA 308
             .|.|  ||::|.:|::|::.:.  |:.|.::|:...|.|..|.:..|:|..|.:.|:|......
  Fly    82 -DPNG--EFFIGLQKLYLMTREQ--PHELFIQLKHGPGATVYAHFDDFQVDSETELYKLERVGKY 141

Human   309 GGDAGDAFDGFDFGDDPSDKFFTSHNGMQFSTWDNDNDKFEGNCAEQDGSGWWMNKCHAGHLNGV 373
            .|.|||:              ...|...:|||:|.|||:...|||.:.|.|||.:.|.:..|||:
  Fly   142 SGTAGDS--------------LRYHINKRFSTFDRDNDESSKNCAAEHGGGWWFHSCLSSSLNGL 192

Human   374 YYQGGTYSKASTPNGYDNGIIWATWK 399
            |::.|       ..|..|||.|..||
  Fly   193 YFREG-------ETGMLNGIHWGRWK 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FGGNP_068656.2 Fib_alpha 31..172 CDD:285864
FReD 175..414 CDD:294064 73/221 (33%)
Gamma-chain polymerization, binding amino end of another fibrin alpha chain 400..422 73/221 (33%)
Platelet aggregation and Staphylococcus clumping 423..437
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 424..453
CG31832NP_723894.2 FReD 28..225 CDD:238040 72/218 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 168 1.000 Inparanoid score I4150
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.860

Return to query results.
Submit another query.