Sequence 1: | NP_001032754.1 | Gene: | Zfp1 / 22640 | MGIID: | 99154 | Length: | 403 | Species: | Mus musculus |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001262965.1 | Gene: | CG4730 / 43099 | FlyBaseID: | FBgn0039355 | Length: | 392 | Species: | Drosophila melanogaster |
Alignment Length: | 350 | Identity: | 90/350 - (25%) |
---|---|---|---|
Similarity: | 136/350 - (38%) | Gaps: | 88/350 - (25%) |
- Green bases have known domain annotations that are detailed below.
Mouse 91 TLNTDFVSLR---QVPYKYDLYEKTLKYNSDLLSSRNCVRKKGDGCGGFGEPLLYLKQEKPHAGL 152
Mouse 153 EYSEYNGNGRALSHKD-------------------------------AIFKHRKI----KSLVQP 182
Mouse 183 FVC---------------NYCDKTFSFKSLLVSHKR--------------IHTGEKPYECDVCQK 218
Mouse 219 TFSHKANLIKHQRIHTGEKP-FECPECGKAFTHQSNLIVHQRAHMEKKPYGCSECGKTFAQKFEL 282
Mouse 283 TTHQRIHTGERPYECNECAKTFFKKSNLIIHQKIHTGEKRYECS--ECGKSFIQNSQLIIHRRTH 345
Mouse 346 TGEKPYECTECGKTFSQRSTLRLHL 370 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Zfp1 | NP_001032754.1 | KRAB | 7..47 | CDD:366587 | |
C2H2 Zn finger | 161..177 | CDD:275368 | 7/50 (14%) | ||
COG5048 | <175..336 | CDD:227381 | 52/196 (27%) | ||
C2H2 Zn finger | 185..205 | CDD:275368 | 4/48 (8%) | ||
C2H2 Zn finger | 213..233 | CDD:275368 | 7/19 (37%) | ||
C2H2 Zn finger | 241..261 | CDD:275368 | 5/19 (26%) | ||
C2H2 Zn finger | 269..289 | CDD:275368 | 9/19 (47%) | ||
C2H2 Zn finger | 297..317 | CDD:275368 | 7/19 (37%) | ||
C2H2 Zn finger | 325..345 | CDD:275368 | 8/21 (38%) | ||
zf-H2C2_2 | 341..362 | CDD:372612 | 8/20 (40%) | ||
C2H2 Zn finger | 353..373 | CDD:275368 | 6/17 (35%) | ||
zf-H2C2_2 | 366..390 | CDD:372612 | 3/4 (75%) | ||
C2H2 Zn finger | 381..401 | CDD:275368 | |||
CG4730 | NP_001262965.1 | zf-AD | 46..124 | CDD:285071 | 14/90 (16%) |
C2H2 Zn finger | 183..203 | CDD:275368 | 7/19 (37%) | ||
C2H2 Zn finger | 212..232 | CDD:275368 | 5/19 (26%) | ||
C2H2 Zn finger | 240..260 | CDD:275368 | 9/19 (47%) | ||
C2H2 Zn finger | 268..289 | CDD:275368 | 7/20 (35%) | ||
C2H2 Zn finger | 296..318 | CDD:275368 | 8/21 (38%) | ||
C2H2 Zn finger | 325..346 | CDD:275368 | 6/17 (35%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |