DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FGFR4 and drpr

DIOPT Version :9

Sequence 1:NP_001341913.1 Gene:FGFR4 / 2264 HGNCID:3691 Length:802 Species:Homo sapiens
Sequence 2:NP_001261276.1 Gene:drpr / 38218 FlyBaseID:FBgn0027594 Length:1042 Species:Drosophila melanogaster


Alignment Length:198 Identity:35/198 - (17%)
Similarity:68/198 - (34%) Gaps:57/198 - (28%)


- Green bases have known domain annotations that are detailed below.


Human   194 ENRIGGIRLRHQHWSLVMESVVPSDRGTYTCLVENAVGSIRYNYLLDVLERSPHRPILQAGLPAN 258
            |.|:....:|.:..:....|.:.:|.|. .|.....|||...||..|:|.::         |.|:
  Fly   863 ETRLLPNNMRSKMNNFDQRSTMSTDYGD-DCNASGRVGSYSINYNHDLLTKN---------LNAD 917

Human   259 TTAVVGSDVELLCKVYSDA--QPHI-QWLKH--------IVINGSSFGADGFPYVQVLKTA---- 308
            .|..:         ||:::  :.|: ..:||        .:.:...|..|.:.::...:.:    
  Fly   918 RTNPI---------VYNESLKEEHVYDEIKHKEGYKDPVKIYSKILFPEDEYDHLDYSRPSTSQK 973

Human   309 -----------DINSSEVEVLYLRNVS---------AEDAGEYTCLAGNSIGLSYQSAWLTVLPE 353
                       :||..|.:...::|::         .|...::.|....:..|...|   |..|.
  Fly   974 PHYHRMNDAMLNINQDEEKPSNVKNMTVLLNKPLPPTEPEPQHECFDNTNTNLDNVS---TASPS 1035

Human   354 EDP 356
            ..|
  Fly  1036 SSP 1038

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FGFR4NP_001341913.1 IGc2 50..107 CDD:197706
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 119..148
Ig 157..241 CDD:325142 12/46 (26%)
Ig3_FGFR-2 264..351 CDD:143266 16/121 (13%)
PKc_like 454..767 CDD:328722
drprNP_001261276.1 EMI 27..92 CDD:284877
EGF_CA 274..319 CDD:304395
DSL <479..518 CDD:302925
DSL <567..606 CDD:302925
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0200
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.