Sequence 1: | NP_001341913.1 | Gene: | FGFR4 / 2264 | HGNCID: | 3691 | Length: | 802 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001261276.1 | Gene: | drpr / 38218 | FlyBaseID: | FBgn0027594 | Length: | 1042 | Species: | Drosophila melanogaster |
Alignment Length: | 198 | Identity: | 35/198 - (17%) |
---|---|---|---|
Similarity: | 68/198 - (34%) | Gaps: | 57/198 - (28%) |
- Green bases have known domain annotations that are detailed below.
Human 194 ENRIGGIRLRHQHWSLVMESVVPSDRGTYTCLVENAVGSIRYNYLLDVLERSPHRPILQAGLPAN 258
Human 259 TTAVVGSDVELLCKVYSDA--QPHI-QWLKH--------IVINGSSFGADGFPYVQVLKTA---- 308
Human 309 -----------DINSSEVEVLYLRNVS---------AEDAGEYTCLAGNSIGLSYQSAWLTVLPE 353
Human 354 EDP 356 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
FGFR4 | NP_001341913.1 | IGc2 | 50..107 | CDD:197706 | |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 119..148 | ||||
Ig | 157..241 | CDD:325142 | 12/46 (26%) | ||
Ig3_FGFR-2 | 264..351 | CDD:143266 | 16/121 (13%) | ||
PKc_like | 454..767 | CDD:328722 | |||
drpr | NP_001261276.1 | EMI | 27..92 | CDD:284877 | |
EGF_CA | 274..319 | CDD:304395 | |||
DSL | <479..518 | CDD:302925 | |||
DSL | <567..606 | CDD:302925 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0200 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |