DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FGFR4 and Btk

DIOPT Version :10

Sequence 1:NP_002002.3 Gene:FGFR4 / 2264 HGNCID:3691 Length:802 Species:Homo sapiens
Sequence 2:NP_476745.1 Gene:Btk / 34132 FlyBaseID:FBgn0003502 Length:786 Species:Drosophila melanogaster


Alignment Length:64 Identity:13/64 - (20%)
Similarity:26/64 - (40%) Gaps:10/64 - (15%)


- Green bases have known domain annotations that are detailed below.


Human   346 ENTNRATL-NYT---------TREFYHEKLEEIKDKKKFCRLYVEDLVKEATAINMKNEALQKL 399
            :|||.:.: |.|         |:.....:...|.:...|...:|:|...:....:|..:::|.|
  Fly     2 QNTNMSNMYNGTTEPLLSLPNTQSLIEPQTPTIPEIYFFILFFVDDFEADLGLGHMDFQSIQML 65

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FGFR4NP_002002.3 Ig_3 36..104 CDD:464046
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 119..148
IgI_2_FGFR 147..241 CDD:409443
Ig strand A 147..150 CDD:409443
Ig strand A' 158..163 CDD:409443
Ig strand B 167..175 CDD:409443
Ig strand C 181..186 CDD:409443
Ig strand C' 189..191 CDD:409443
Ig strand D 200..203 CDD:409443
Ig strand E 207..212 CDD:409443
Ig strand F 221..228 CDD:409443
Ig strand G 231..241 CDD:409443
Ig 249..351 CDD:472250 3/4 (75%)
Ig strand B 267..271 CDD:409444
Ig strand C 280..284 CDD:409444
Ig strand E 316..320 CDD:409444
Ig strand F 330..335 CDD:409444
Ig strand G 343..346 CDD:409444 13/64 (20%)
Protein Kinases, catalytic domain 454..767 CDD:473864
BtkNP_476745.1 PH_Btk 44..222 CDD:269944 5/22 (23%)
SH3_Tec_like 346..399 CDD:212702
SH2_Tec_family 403..505 CDD:198188
PTKc_Tec_like 521..778 CDD:173637
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.