DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ywhaq and 14-3-3zeta

DIOPT Version :9

Sequence 1:NP_035869.1 Gene:Ywhaq / 22630 MGIID:891963 Length:245 Species:Mus musculus
Sequence 2:NP_001014515.1 Gene:14-3-3zeta / 36059 FlyBaseID:FBgn0004907 Length:248 Species:Drosophila melanogaster


Alignment Length:245 Identity:188/245 - (76%)
Similarity:213/245 - (86%) Gaps:0/245 - (0%)


- Green bases have known domain annotations that are detailed below.


Mouse     1 MEKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSVAYKNVVGGRRSAWRVISSI 65
            ::|.||:||||||||:|||||||..||:|||.|.|||||||||||||||||||.|||:|||||||
  Fly     4 VDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVAYKNVVGARRSSWRVISSI 68

Mouse    66 EQKTDTSDKKLQLIKDYREKVESELRSICTTVLELLDKYLIANATNPESKVFYLKMKGDYFRYLA 130
            ||||:.|.:|.||.::|||:||.|||.||..||.|||||||..|:|||||||||||||||:||||
  Fly    69 EQKTEASARKQQLAREYRERVEKELREICYEVLGLLDKYLIPKASNPESKVFYLKMKGDYYRYLA 133

Mouse   131 EVACGDDRKQTIENSQGAYQEAFDISKKEMQPTHPIRLGLALNFSVFYYEILNNPELACTLAKTA 195
            |||.||.|...:::||.|||:||||||.:||||||||||||||||||||||||:|:.||.|||.|
  Fly   134 EVATGDARNTVVDDSQTAYQDAFDISKGKMQPTHPIRLGLALNFSVFYYEILNSPDKACQLAKQA 198

Mouse   196 FDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDSAGEECDAAEGAEN 245
            ||:|||||||||||||||||||||||||||||||||:.|:|.:..||.:|
  Fly   199 FDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEAEPQEGGDN 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
YwhaqNP_035869.1 14-3-3_theta 1..234 CDD:206759 183/232 (79%)
14-3-3zetaNP_001014515.1 14-3-3 5..234 CDD:413191 181/228 (79%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167850045
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5040
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53683
OrthoDB 1 1.010 - - D1176818at2759
OrthoFinder 1 1.000 - - FOG0000128
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR18860
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.860

Return to query results.
Submit another query.