DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FGFR2 and drpr

DIOPT Version :9

Sequence 1:XP_006717771.1 Gene:FGFR2 / 2263 HGNCID:3689 Length:839 Species:Homo sapiens
Sequence 2:NP_001261276.1 Gene:drpr / 38218 FlyBaseID:FBgn0027594 Length:1042 Species:Drosophila melanogaster


Alignment Length:346 Identity:65/346 - (18%)
Similarity:115/346 - (33%) Gaps:118/346 - (34%)


- Green bases have known domain annotations that are detailed below.


Human   108 GEYLQIKGATPRDSGLYACTASRTVDSETWYFMVNVTDAISSGDDEDDTDGAEDFVSENSNNKRA 172
            ||:.....|.|  |..:.|.|:......:.|          :||:.|:...::....::.|:.||
  Fly   747 GEHCMNTCACP--SANFQCHAAHGCVCRSGY----------TGDNCDELIASQRIADQSENSSRA 799

Human   173 P--------------------YW----TNTEKMEKRLHAVPAANTVKFRCPAG---GNPMPTMRW 210
            .                    |:    :|.:.....:|.....|...:  |..   .||:..|  
  Fly   800 SVALTLVLMTLFACIIFAVFIYYRRRVSNLKTEIAHVHYTHDTNPPSW--PPNHNFDNPVYGM-- 860

Human   211 LKNGKEFKQEHRIGGYKVRNQHWSLIMESVVPSDKGNYTCVVENEYGSINHTYHLDVVERSPHRP 275
                   :.|.|:....:|::..:....|.:.:|.|: .|......||.:..|:.|         
  Fly   861 -------QAETRLLPNNMRSKMNNFDQRSTMSTDYGD-DCNASGRVGSYSINYNHD--------- 908

Human   276 ILQAGLPANASTVVGGDVEFVCKVYSDA--QPHI-QWIKHVEKNGSKYGPDGLPYLKVL----KH 333
            :|...|.|:.:..:         ||:::  :.|: ..|||  |.|.| .|..: |.|:|    ::
  Fly   909 LLTKNLNADRTNPI---------VYNESLKEEHVYDEIKH--KEGYK-DPVKI-YSKILFPEDEY 960

Human   334 SGINSSNAEVL----------ALFNVTEADAGEYICKVSNYIGQANQSAWLTVLPKQQAPGREKE 388
            ..::.|.....          |:.|:.:.:  |....|.|          :|||..:..|..|.|
  Fly   961 DHLDYSRPSTSQKPHYHRMNDAMLNINQDE--EKPSNVKN----------MTVLLNKPLPPTEPE 1013

Human   389 ----------------ITASP 393
                            .||||
  Fly  1014 PQHECFDNTNTNLDNVSTASP 1034

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FGFR2XP_006717771.1 Ig1_FGFR 66..143 CDD:143174 8/34 (24%)
IG_like 66..143 CDD:214653 8/34 (24%)
Ig2_FGFR 183..267 CDD:143265 16/86 (19%)
IG_like 282..376 CDD:214653 20/110 (18%)
Ig3_FGFR 290..377 CDD:143175 20/103 (19%)
PTKc_FGFR2 474..786 CDD:270679
Pkinase_Tyr 499..775 CDD:285015
drprNP_001261276.1 EMI 27..92 CDD:284877
EGF_CA 274..319 CDD:304395
DSL <479..518 CDD:302925
DSL <567..606 CDD:302925
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0200
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.