DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ywhah and 14-3-3epsilon

DIOPT Version :9

Sequence 1:NP_035868.1 Gene:Ywhah / 22629 MGIID:109194 Length:246 Species:Mus musculus
Sequence 2:NP_732309.1 Gene:14-3-3epsilon / 42186 FlyBaseID:FBgn0020238 Length:262 Species:Drosophila melanogaster


Alignment Length:249 Identity:157/249 - (63%)
Similarity:191/249 - (76%) Gaps:6/249 - (2%)


- Green bases have known domain annotations that are detailed below.


Mouse     1 MGDREQLLQRARLAEQAERYDDMASAMKAVTELNEPLSNEDRNLLSVAYKNVVGARRSSWRVISS 65
            |.:||..:.:|:|||||||||:|..|||.|..::..|:.|:|||||||||||:||||:|||:|:|
  Fly     1 MTERENNVYKAKLAEQAERYDEMVEAMKKVASMDVELTVEERNLLSVAYKNVIGARRASWRIITS 65

Mouse    66 IEQKTMADGNEKKLEKVKAYREKIEKELETVCNDVLALLDKFLIKNCNDFQYESKVFYLKMKGDY 130
            ||||....|.|:|||.:|.||.::||||..:|:|:|.:|:|.||....  ..||||||.||||||
  Fly    66 IEQKEENKGAEEKLEMIKTYRGQVEKELRDICSDILNVLEKHLIPCAT--SGESKVFYYKMKGDY 128

Mouse   131 YRYLAEVASGEKKNSVVEASEAAYKEAFEISKEHMQPTHPIRLGLALNFSVFYYEIQNAPEQACL 195
            :|||||.|:|..:....|.|..|||.|.:|:...:.||||||||||||||||||||.|:|::||.
  Fly   129 HRYLAEFATGSDRKDAAENSLIAYKAASDIAMNDLPPTHPIRLGLALNFSVFYYEILNSPDRACR 193

Mouse   196 LAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDEE----AGEG 245
            |||.||||||||||||:|:||||||||||||||||||||||.|.||    ||:|
  Fly   194 LAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQAEEVDPNAGDG 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
YwhahNP_035868.1 14-3-3_eta 3..241 CDD:206761 151/237 (64%)
14-3-3epsilonNP_732309.1 14-3-3_epsilon 4..233 CDD:206757 147/230 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5040
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53683
OrthoDB 1 1.010 - - D1176818at2759
OrthoFinder 1 1.000 - - FOG0000128
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.