DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FGFR3 and drpr

DIOPT Version :9

Sequence 1:XP_006713931.1 Gene:FGFR3 / 2261 HGNCID:3690 Length:811 Species:Homo sapiens
Sequence 2:NP_001261276.1 Gene:drpr / 38218 FlyBaseID:FBgn0027594 Length:1042 Species:Drosophila melanogaster


Alignment Length:385 Identity:81/385 - (21%)
Similarity:117/385 - (30%) Gaps:139/385 - (36%)


- Green bases have known domain annotations that are detailed below.


Human    54 GDAVELSCPPPGGG----------------PM-GPTVWVKDGTGLVPSERVLVGPQRLQVLNAS- 100
            |.|.:::|||...|                |. |.....|..||...::   :.|:.....|.| 
  Fly   125 GPACDINCPPGWYGRNCSMQCDCLNNAVCEPFSGDCECAKGYTGARCAD---ICPEGFFGANCSE 186

Human   101 ----------HEDSGAYSCRQRLTQRVLC--------HFSVRVTDAPSSGDDEDGEDEAEDTGVD 147
                      |..||...|....| ..||        |.:....|.|.   ..||:.:.| ||..
  Fly   187 KCRCENGGKCHHVSGECQCAPGFT-GPLCDMRCPDGKHGAQCQQDCPC---QNDGKCQPE-TGAC 246

Human   148 TGAPYWTRPERMDKKLLAVPAANTVRFRCPAA--------------GNPTPSISWLKNGR----- 193
            ...|.||              .:....:||..              |.|...|:    |:     
  Fly   247 MCNPGWT--------------GDVCANKCPVGSYGPGCQESCECYKGAPCHHIT----GQCECPP 293

Human   194 EFRGEHRIGGIKLRHQQWSLVM----ESVVPSDRGNYTCVVENKFGSIRQTYTLDVLERSPHRPI 254
            .:|||......:|....::..|    .:....||.|.||:....:...:      ..||     |
  Fly   294 GYRGERCFDECQLNTYGFNCSMTCDCANDAMCDRANGTCICNPGWTGAK------CAER-----I 347

Human   255 LQA---GLPANQTAVLGSDVEF-----------HCKV-YSDAQ-----PHIQWLKHVEV-----N 294
            .:|   ||..|:|.  ..|:|.           .|.: :|.||     ..:::..:.|:     |
  Fly   348 CEANKYGLDCNRTC--ECDMEHTDLCHPETGNCQCSIGWSSAQCTRPCTFLRYGPNCELTCNCKN 410

Human   295 GSKVGP-DGTPYVTVLKSW----ISESVE-----ADVRLRL----ANVSERDGGEYLCRA 340
            |:|..| :||  ......|    ..||.|     .|..||.    ....|.:.|:.||.|
  Fly   411 GAKCSPVNGT--CLCAPGWRGPTCEESCEPGTFGQDCALRCDCQNGAKCEPETGQCLCTA 468

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FGFR3XP_006713931.1 IGc2 53..110 CDD:197706 17/83 (20%)
IG 54..125 CDD:214652 22/106 (21%)
Ig2_FGFR 161..245 CDD:143265 16/106 (15%)
IG_like 171..245 CDD:214653 16/96 (17%)
IG_like 260..355 CDD:214653 27/117 (23%)
Ig3_FGFR 268..356 CDD:143175 25/109 (23%)
PKc_like 463..797 CDD:304357
Pkinase_Tyr 476..752 CDD:285015
drprNP_001261276.1 EMI 27..92 CDD:284877
EGF_CA 274..319 CDD:304395 9/48 (19%)
DSL <479..518 CDD:302925
DSL <567..606 CDD:302925
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0200
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.