DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FGFR3 and skb5

DIOPT Version :10

Sequence 1:XP_006713931.1 Gene:FGFR3 / 2261 HGNCID:3690 Length:811 Species:Homo sapiens
Sequence 2:NP_588016.1 Gene:skb5 / 2539237 PomBaseID:SPCC24B10.13 Length:140 Species:Schizosaccharomyces pombe


Alignment Length:58 Identity:15/58 - (25%)
Similarity:23/58 - (39%) Gaps:9/58 - (15%)


- Green bases have known domain annotations that are detailed below.


Human   744 TFKQLVEDLDRVLTVTSTDQEYLDLSAPFEQYSPGGQDTPSSSSSG-DDSVFAHDLLP 800
            ||.:.:|..|        |.|.:|.:..|..........||:|.:. .|:|..:|..|
pombe    44 TFDETIEGSD--------DSESIDDTEVFYDAEESESTHPSASFNVLADAVALYDFEP 93

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FGFR3XP_006713931.1 Ig 37..109 CDD:472250
Ig strand B 57..61 CDD:409362
Ig strand C 69..75 CDD:409362
Ig strand E 92..96 CDD:409362
IgI_2_FGFR 151..245 CDD:409443
Ig strand A 151..154 CDD:409443
Ig strand A' 162..167 CDD:409443
Ig strand B 171..179 CDD:409443
Ig strand C 185..190 CDD:409443
Ig strand C' 193..195 CDD:409443
Ig strand D 204..207 CDD:409443
Ig strand E 211..216 CDD:409443
Ig strand F 225..232 CDD:409443
Ig strand G 235..245 CDD:409443
IgI_3_FGFR 253..354 CDD:409363
Ig strand A 253..256 CDD:409363
Ig strand A' 260..264 CDD:409363
Ig strand B 272..279 CDD:409363
Ig strand C 283..290 CDD:409363
Ig strand D 305..310 CDD:409363
Ig strand E 321..326 CDD:409363
Ig strand F 334..342 CDD:409363
Ig strand G 345..353 CDD:409363
Protein Kinases, catalytic domain 463..797 CDD:473864 13/53 (25%)
skb5NP_588016.1 SH3_Nbp2-like 84..138 CDD:212799 4/10 (40%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.