| Sequence 1: | XP_006713931.1 | Gene: | FGFR3 / 2261 | HGNCID: | 3690 | Length: | 811 | Species: | Homo sapiens |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_588016.1 | Gene: | skb5 / 2539237 | PomBaseID: | SPCC24B10.13 | Length: | 140 | Species: | Schizosaccharomyces pombe |
| Alignment Length: | 58 | Identity: | 15/58 - (25%) |
|---|---|---|---|
| Similarity: | 23/58 - (39%) | Gaps: | 9/58 - (15%) |
- Green bases have known domain annotations that are detailed below.
|
Human 744 TFKQLVEDLDRVLTVTSTDQEYLDLSAPFEQYSPGGQDTPSSSSSG-DDSVFAHDLLP 800 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| FGFR3 | XP_006713931.1 | Ig | 37..109 | CDD:472250 | |
| Ig strand B | 57..61 | CDD:409362 | |||
| Ig strand C | 69..75 | CDD:409362 | |||
| Ig strand E | 92..96 | CDD:409362 | |||
| IgI_2_FGFR | 151..245 | CDD:409443 | |||
| Ig strand A | 151..154 | CDD:409443 | |||
| Ig strand A' | 162..167 | CDD:409443 | |||
| Ig strand B | 171..179 | CDD:409443 | |||
| Ig strand C | 185..190 | CDD:409443 | |||
| Ig strand C' | 193..195 | CDD:409443 | |||
| Ig strand D | 204..207 | CDD:409443 | |||
| Ig strand E | 211..216 | CDD:409443 | |||
| Ig strand F | 225..232 | CDD:409443 | |||
| Ig strand G | 235..245 | CDD:409443 | |||
| IgI_3_FGFR | 253..354 | CDD:409363 | |||
| Ig strand A | 253..256 | CDD:409363 | |||
| Ig strand A' | 260..264 | CDD:409363 | |||
| Ig strand B | 272..279 | CDD:409363 | |||
| Ig strand C | 283..290 | CDD:409363 | |||
| Ig strand D | 305..310 | CDD:409363 | |||
| Ig strand E | 321..326 | CDD:409363 | |||
| Ig strand F | 334..342 | CDD:409363 | |||
| Ig strand G | 345..353 | CDD:409363 | |||
| Protein Kinases, catalytic domain | 463..797 | CDD:473864 | 13/53 (25%) | ||
| skb5 | NP_588016.1 | SH3_Nbp2-like | 84..138 | CDD:212799 | 4/10 (40%) |
| Blue background indicates that the domain is not in the aligned region. | |||||