DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Yap1 and Nedd4

DIOPT Version :9

Sequence 1:XP_006509915.1 Gene:Yap1 / 22601 MGIID:103262 Length:494 Species:Mus musculus
Sequence 2:NP_648993.1 Gene:Nedd4 / 39958 FlyBaseID:FBgn0259174 Length:1007 Species:Drosophila melanogaster


Alignment Length:310 Identity:77/310 - (24%)
Similarity:116/310 - (37%) Gaps:80/310 - (25%)


- Green bases have known domain annotations that are detailed below.


Mouse    24 AGTPAAPPAPPAGHQ------VVHVRGDSETD-----LEALFNAVMNPKTANVPQTVPMRLRK-- 75
            |.|.:|||..|..:.      .:..|.:.:.|     ...::|::.:|.....|:.....|:.  
  Fly   337 AATSSAPPNTPTNNNGILAQIAMQYRAEEDQDPTVDHTSFVYNSLRHPVAHRQPEISATSLQNDL 401

Mouse    76 --------LPDSFFKPPEPKSHSRQASTDAGTAGALTPQ-------HVRAHSSPASLQ-----LG 120
                    :||.....|..:   |.|...||.||....:       |::.|......|     |.
  Fly   402 RPVREAPGVPDIAITNPFTR---RAAGNMAGGAGWQQERRRQQMQLHIQQHQQRQQQQQQNRILL 463

Mouse   121 AVS------------------PGTLTASGVVSGPAAAPAAQHLRQSSFE----IP--------DD 155
            .|.                  |.........|...:..:|...|::|.|    :|        ::
  Fly   464 DVDHRQQEPQHRGQRHQQQHRPSNEDTDHTDSHNPSDISAPSTRRNSEEDNAAVPPMEQNTGGEE 528

Mouse   156 VPLPAGWEMAKTSSGQRYFLNHNDQTTTWQDPRKAMLSQLNVPAPASPAVPQT-LMNSASGPLPD 219
            .|||..|.|....:|:.:|::|..:.|||.|||...         |||...|| .:....||||:
  Fly   529 EPLPPRWSMQVAPNGRTFFIDHASRRTTWIDPRNGR---------ASPMPNQTRRVEDDLGPLPE 584

Mouse   220 GWEQAMTQDGEVYYINHKNKTTSWLDPRL-DPRFGKAMNQRITQSAPVKQ 268
            |||:.:..||.|:||:|..:||.|.|||| :|...   .|.:..|...||
  Fly   585 GWEERVHTDGRVFYIDHNTRTTQWEDPRLSNPNIA---GQAVPYSRDYKQ 631

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Yap1XP_006509915.1 FAM181 <61..>141 CDD:373671 18/119 (15%)
WW 159..188 CDD:238122 10/28 (36%)
WW 217..246 CDD:366073 14/28 (50%)
Nedd4NP_648993.1 C2_NEDD4_NEDD4L 71..204 CDD:175999
WW 248..277 CDD:278809
WW 531..560 CDD:278809 10/28 (36%)
WW 581..613 CDD:197736 17/31 (55%)
HECTc 650..1003 CDD:238033
HECTc 674..1003 CDD:214523
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.