DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cplx4 and cpx

DIOPT Version :10

Sequence 1:NP_663468.1 Gene:Cplx4 / 225644 MGIID:2685803 Length:160 Species:Mus musculus
Sequence 2:NP_001262248.1 Gene:cpx / 64877 FlyBaseID:FBgn0041605 Length:157 Species:Drosophila melanogaster


Alignment Length:124 Identity:36/124 - (29%)
Similarity:55/124 - (44%) Gaps:15/124 - (12%)


- Green bases have known domain annotations that are detailed below.


Mouse     2 AFFVKNMISNQVKNL-GFGGGSEEKKEEGGTSDPAAAKGMTREEYEEYQKQMIEEKMERDAAFTQ 65
            ||..|.|:.||:..: |..||      :||  |....|....||..|.|:.:.|.:..|.....:
  Fly     3 AFIAKQMVGNQLSAVKGAVGG------DGG--DDGDDKEKAEEEERERQEAIKEAEDRRKEKHRK 59

Mouse    66 KKAERACLRVHLRDKYRLPKSEMDETQIQLAGDDVDLPEDLRKMVDED---QDEEEEKD 121
            .:.||..:|..:||||.:.|.   |..::.|..:...|...:|...|:   :.|:||.|
  Fly    60 MEEEREKMRQDIRDKYNIKKK---EEIVEAAPQEEPNPLMRKKKTPEELAAEAEQEELD 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cplx4NP_663468.1 Synaphin 1..140 CDD:461755 36/124 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 14..44 7/30 (23%)
cpxNP_001262248.1 Synaphin 2..124 CDD:461755 36/124 (29%)

Return to query results.
Submit another query.