DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FGB and CG9500

DIOPT Version :9

Sequence 1:NP_005132.2 Gene:FGB / 2244 HGNCID:3662 Length:491 Species:Homo sapiens
Sequence 2:NP_609018.3 Gene:CG9500 / 33888 FlyBaseID:FBgn0031804 Length:292 Species:Drosophila melanogaster


Alignment Length:331 Identity:98/331 - (29%)
Similarity:153/331 - (46%) Gaps:76/331 - (22%)


- Green bases have known domain annotations that are detailed below.


Human   172 YSSELEKHQLYIDETVNSNIP---TNLRVLRSILENLRS-----KIQKLESDVSAQMEYCRTPCT 228
            ||:|....:.:.::|...|.|   :..:::.::||..:|     .|||..||:            
  Fly    16 YSTEAMDSESFQNDTAIRNKPELKSLYKLVLALLEENQSNASTENIQKSSSDL------------ 68

Human   229 VSCNIPVVSGK---ECEEIIRKGGETSEMYLIQPDSSVKPYRVYCDMNTENGGWTVIQNRQDGSV 290
               |...:||:   :|.......|    :|.:|. ..:||::|.||......||||:..|....:
  Fly    69 ---NTTGLSGRYPSQCPTYPPAHG----IYTVQV-LGLKPFQVSCDAEIAGTGWTVMARRTSNKL 125

Human   291 DFGRKWDPYKQGFGNVATNTDGKNYCGLPGEYWLGNDKISQLTRMGPTELLIEMEDWKGDKVKAH 355
            :|.|.|..||.|||.            |.|::::|.||:..:|:..|.||.|.:||::|....||
  Fly   126 NFFRSWAEYKNGFGQ------------LDGDFFIGLDKLHAITKSQPHELYIHLEDFEGQTRYAH 178

Human   356 YGGFTVQNEANKYQIS-VNKYRGTAGNALMDGASQLMGENRTMTIHN-GMFFSTYDRDNDGWLTS 418
            |....:::|...|.:: :.::.|.||:::               ||| ...|||:|||||||   
  Fly   179 YDEIFIESENKFYAMTKLGEFTGDAGDSM---------------IHNRNQNFSTFDRDNDGW--- 225

Human   419 DPRKQCSKEDGGGWWYNRCHAANPNGRYYWG--GQY-TWDMAKHGTDDGVVWMNWKGSWYSMRKM 480
              .|.|::|..|.||:..|..:|..|.|..|  ||| .|        .|:||.:|:...||.:.|
  Fly   226 --HKNCAEEYVGAWWHLNCTYSNLFGIYVKGDEGQYFQW--------KGIVWHSWRTESYSYKVM 280

Human   481 SMKIRP 486
            .|.:||
  Fly   281 QMMVRP 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FGBNP_005132.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 44..75
Beta-chain polymerization, binding distal domain of another fibrin 45..47
Fib_alpha 92..234 CDD:312286 15/69 (22%)
FReD 237..486 CDD:294064 81/256 (32%)
CG9500NP_609018.3 FReD 76..287 CDD:238040 81/256 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.