DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FGB and CG31832

DIOPT Version :9

Sequence 1:NP_005132.2 Gene:FGB / 2244 HGNCID:3662 Length:491 Species:Homo sapiens
Sequence 2:NP_723894.2 Gene:CG31832 / 318970 FlyBaseID:FBgn0051832 Length:227 Species:Drosophila melanogaster


Alignment Length:233 Identity:79/233 - (33%)
Similarity:117/233 - (50%) Gaps:46/233 - (19%)


- Green bases have known domain annotations that are detailed below.


Human   256 LIQPDSSVKPYRVYCDMNTENGGWTVIQNRQDGSVDFGRKWDPYKQGFGNVATNTDGKNYCGLP- 319
            |:.|:.  :|::| ....|....|.|||.|.||||:|.:.|..||.|||:             | 
  Fly    36 LMLPEE--EPFQV-TQCKTTARDWIVIQRRLDGSVNFNQSWFSYKDGFGD-------------PN 84

Human   320 GEYWLGNDKISQLTRMGPTELLIEMEDWKGDKVKAHYGGFTVQNEANKYQIS-VNKYRGTAGNAL 383
            ||:::|..|:..:||..|.||.|:::...|..|.||:..|.|.:|...|::. |.||.||||::|
  Fly    85 GEFFIGLQKLYLMTREQPHELFIQLKHGPGATVYAHFDDFQVDSETELYKLERVGKYSGTAGDSL 149

Human   384 MDGASQLMGENRTMTIHNGMFFSTYDRDNDGWLTSDPRKQCSKEDGGGWWYNRCHAANPNGRYYW 448
                          ..|....|||:|||||     :..|.|:.|.|||||::.|.:::.||.|:.
  Fly   150 --------------RYHINKRFSTFDRDND-----ESSKNCAAEHGGGWWFHSCLSSSLNGLYFR 195

Human   449 GGQYTWDMAKHGTDDGVVWMNWKGSWYSMRKMSMKIRP 486
            .|:       .|..:|:.|..||  :.|:..:.:.|||
  Fly   196 EGE-------TGMLNGIHWGRWK--FQSLTFVQIMIRP 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FGBNP_005132.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 44..75
Beta-chain polymerization, binding distal domain of another fibrin 45..47
Fib_alpha 92..234 CDD:312286
FReD 237..486 CDD:294064 77/231 (33%)
CG31832NP_723894.2 FReD 28..225 CDD:238040 79/233 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 168 1.000 Inparanoid score I4150
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.860

Return to query results.
Submit another query.